SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012909123.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012909123.1.14098
Domain Number 1 Region: 459-637
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-50
Family SPRY domain 0.00079
Further Details:      
 
Domain Number 2 Region: 8-80
Classification Level Classification E-value
Superfamily RING/U-box 1.7e-19
Family RING finger domain, C3HC4 0.0083
Further Details:      
 
Domain Number 3 Region: 149-209
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000565
Family B-box zinc-binding domain 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012909123.1.14098
Sequence length 653
Comment PREDICTED: E3 ubiquitin/ISG15 ligase TRIM25 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MAELVPLAEELSCSICLEPFKEPVTTPCGHNFCGLCLDETWAVQGSPYLCPQCRASYHAR
PQLRKNTVLCAVVEQFLQAEEARATPPPPDDWKLPTRAATPSPAGPVACDHCLKEAAVKT
CLVCMASFCREHLQPHLDSPAFRDHQLQPPVQDLMRRKCPRHNRLRELFCPQHDECICHI
CLVEHKACSPVPLSQASADLETKLKHKLTVIYSQINGASRALEDVRARQHDVRETTNRRM
EQLRQEYMEIKALIDAAEVTSTRKIKEEEKRVNTKFDNIYQILLKKRSEIQNLKEAVELA
LTKGDEFEFLEKGLKLQGVSTKPVYVPKVELNQELIRGVCQGTSDLKDELKRYIRQSQDK
KPEEPTSSGNPGEHGPAPTHKPTHSAKKGPKEEKKAKKPPPASAFKMPTLGALATKMPTF
GAQGESVDLEGIGKAPTAQPNAAAVKAKVLETFLAKSRPELLEYAVKFSLDYNTAHNKVA
LSENYTVASVAESPLNYQPHPKRFMYCSQVLGLHCYKKGIHYWEVELQKNNFCGVGVCYG
SMPRQGPESRLGRNSASWCVEWFNTKISAWHNNVEKTLPSTKATRVGVLLNCDHGFVIFF
AVSDKVHLMYKFKVDFTEALYPAFWVFSAGAMLSICSYKESAAAACSSPGDVA
Download sequence
Identical sequences M3YVB8
ENSMPUP00000015278 XP_012909123.1.14098 ENSMPUP00000015278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]