SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012909313.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012909313.1.14098
Domain Number 1 Region: 148-218
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000764
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 2 Region: 208-268
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000236
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 3 Region: 89-130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000614
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 4 Region: 44-85
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000309
Family EGF-type module 0.012
Further Details:      
 
Domain Number 5 Region: 517-594
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000088
Family Fibronectin type III 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012909313.1.14098
Sequence length 872
Comment PREDICTED: sushi domain-containing protein 1 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MIPHRASDVCATCHEHATCKQAEGMKMCVCKYGFVGNGRTYCMDKNECQFGATVVCGNHT
SCHNTLGGFYCICLEGYRATNNNKTFIPNDGTFCTDIDECEVSGLCRQGGRCVNTYGSFE
CYCMDGYFPENGPEPFHPARDTTSCIEIDCGLPPEVPDGLIVGNYTSRLGSQVRYACKEG
FFSDLEDTVSSCTALGTWESPKLHCQEIKCGRPPEVRHAVLVGNHSSSPGSVAHYVCQEG
FESPGGKITSVCTEKGTWRKSALTCTEIITEIRAVSVFNNTCVRWQVNPGSILSKTVYMI
YIKGQRLYSMESVHEETVNVTTESRTPEVCLDLHRGTNYTMSISTAPPMRSMPAIIGFQT
AEDDLLEDGGIFNISVFSEACLKLSRHPRKLGSEQMYQFQVLGQRWYLNNFYHATSFNFT
TRERTPVVCLDLYPATDYTVNVTLLGSSEQQSVQITMTTAPAVKQIIGNISVFNETCLRW
RSTKTADTEEMYLFYIRGQRWYQKEFAQEMTFNMTAHSQAPEMCLDLRPGTNYSIRIQAW
SSQLPVVLPLTTHIAEPPPPEVDFVTVHGGPLPRLKLRKAKEKNGPISSYQVLVLPLMLQ
NTFLCDSEGAASFFSNTSDAEGYVAAELLAKDVPDDSMEMSIGDRLYYGKYYNAPLKKGN
DYCIILRITSEWNEVRRCSCAVWAQVKDSSFMPQQMVAVGLGSMAVVIVLAFLAFLAVWY
VRLSFLRNCRRVLRAEEAALLGQVLGQLLRCLPTQRPCAASVRVCVVLQRFPFPAWPHFW
IQDGEYLCGTPPSGGSSEIADVFSAGYTTSSVSVNLRPLIDNVVLTTGYGSCGPDVRVLP
ESQLFWTLNAGQSLHLYSIPGLIWNPSFYNEW
Download sequence
Identical sequences XP_012909313.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]