SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012909578.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012909578.1.14098
Domain Number 1 Region: 495-552
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.07e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 271-328
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.24e-22
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 3 Region: 551-608
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.26e-21
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 4 Region: 10-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.67e-20
Family KRAB domain (Kruppel-associated box) 0.00091
Further Details:      
 
Domain Number 5 Region: 187-242
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.56e-19
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 593-645
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.61e-18
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 7 Region: 440-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-17
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 8 Region: 328-384
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.76e-17
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 9 Region: 149-201
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.42e-17
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 10 Region: 383-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000183
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 11 Region: 93-146
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000907
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 12 Region: 234-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000179
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012909578.1.14098
Sequence length 652
Comment PREDICTED: zinc finger protein 709-like [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MGQAVDLWDSQDSVAFEDVTVHFSLEEWALLNPSQKKLYRDVMQETLRNLALVGEKWEDR
NGKSLYEHHQTNLSKPVVESPCKNKEGSPCEESFSQNPNHKQINKTPAGIKLRKCSFCGQ
VFRHHSSFSRHMISHTGHKLYEYQEYEEKPYKCKECGKAFKHRQSIRVHVRTHTGEKPYK
CKHCGKAFKHCQSIRKHERIHTGEKPYECKQCGEAFRYRHNFQKHERTHTGEQPYRCKHC
GKALSCLSYCRIHERTHTGEKPYECKQCGKAFSYASYIRIHERTHTGEKPYECKKCGKAF
SCPNYFRKHEKTHTGEKPYECKQCGKGFSCPRSFRSHEKRHRGEKPYECKICGKTYSCPI
YFRNHERRHSGEKSYQCKICGKAFSCPKYFRKHERSHTGEEPCECKDCENSLTPLPVFQT
HVVKHSGDGPYKCKECGKVFDCPTNFRCHEKIHSGEKPHECKECGKAFGSSMSLQNHERS
HSRKKPHACKECGKAFSFPCSLQKHERSHTGEKPYACKQCGKAFTYLSSVQKHERTHSGE
KPYACKQCGKAFIYLSSMQKHERTHSGEKPYECEQCGKAFITLSNVQRHMIKHTGDGPCK
CKECGKAFDCPSSLRTHERTHTGEKPYQCKHCSKAFTRSSSLRNHERTHNGE
Download sequence
Identical sequences XP_012909578.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]