SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012909579.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012909579.1.14098
Domain Number 1 Region: 428-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.52e-24
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 2 Region: 372-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.35e-23
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 3 Region: 260-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.52e-22
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 4 Region: 540-597
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.5e-22
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 5 Region: 484-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-21
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 6 Region: 2-52
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.32e-20
Family KRAB domain (Kruppel-associated box) 0.00044
Further Details:      
 
Domain Number 7 Region: 582-634
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.52e-20
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 8 Region: 321-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.35e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 9 Region: 222-274
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.61e-18
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 10 Region: 172-221
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000568
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Weak hits

Sequence:  XP_012909579.1.14098
Domain Number - Region: 62-103
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0327
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012909579.1.14098
Sequence length 640
Comment PREDICTED: zinc finger protein 791 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MDSVTFEDVAVNFTLEEWVLLDSSQKKLYRDVMRETFRNLASIGKKWEGHDTEDGYYTQG
RKLRIHMVEKPYENKEDHCGETITQTPDLNLNKESPSGIKPSEGPQYRETITQTPDLILN
KKTPSGVKSPEGHQCGETITQTPDLSLNKKSPSGIKPPEGLQCRETIIQTPDLNLNKGTP
SGVKPCECSVCGKVFVRHSSLSRHIRSHSGHKPYEYHECEKKPYKCKECGKAFSYRKSVH
RHERTHTGEKPYECQECGKAFTWLTTYRRHMITHTGEGPYKCKECGKAFSCSTSLRTHER
THTGEKPYQCKQCGKSLRSPLGLRIHERNHTGEKPYECKQCGKALSCPSSFRRHERTHTA
EKQYECKQCEKTFSSPLGLRIHERIHTGEKPYECEECGKAFISLSSIRTHMITHTGDGPY
KCKECGKAFICPSSFRSHERTHTGEKPYECKQCGKTFSWPSSFRIHERTHTGEKPYECKE
CGKTFIYRTTFQGHMRKHTGEKPYKCKECGKAFISPSSVRTHMIMHTGDGPYKCKECGKA
FNFPSSFRIHERTHTGEKPYECKQCGRAFSCYTSFRTHEKTHTGEKPYECKECGKAFIYR
TTFRGHVRMHTGEKPYKCKECGKAFSRPNSFRRHERSHTE
Download sequence
Identical sequences M3Y0L0
XP_012909579.1.14098 ENSMPUP00000004861 ENSMPUP00000004861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]