SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012911058.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012911058.1.14098
Domain Number 1 Region: 313-485,525-682
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 4.36e-135
Family Mammalian PLC 0.0000000341
Further Details:      
 
Domain Number 2 Region: 914-968,1008-1158
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 3.92e-59
Family C-terminal domain of PLC-beta 0.0011
Further Details:      
 
Domain Number 3 Region: 141-312
Classification Level Classification E-value
Superfamily EF-hand 8.15e-55
Family EF-hand modules in multidomain proteins 0.00044
Further Details:      
 
Domain Number 4 Region: 12-140
Classification Level Classification E-value
Superfamily PH domain-like 1.69e-40
Family Pleckstrin-homology domain (PH domain) 0.00081
Further Details:      
 
Domain Number 5 Region: 704-819
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.49e-27
Family PLC-like (P variant) 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012911058.1.14098
Sequence length 1194
Comment PREDICTED: 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 isoform X2 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MAKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWRSEGKEGQVL
ECSLINSIRLGATPKDPKILAALEAVGKSENDLEGRIVCVCSGTDLVNISFTYMVAENPE
VTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKNKGLISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
SKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKNKRLKPEVEKKQLEALKSM
MEAGESAAPVSILEDDNEEEIESADQEEEAHPEYKFGNELSADDLGHKEAVANSVKKGLV
TVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVG
LGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQL
NQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGT
YVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLAVLRIAVYDDNNR
LIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKK
FLSITEKRADQMRAMGIETSDIADVPSDTSKNDKKGKANTAKANVTPQSSSELRPTTTAA
LGSGVEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQ
VDKMVAQYDKEKSTHEKILEKAMKKKGGSNCLEMKKETEIKIQTLTSDHKSKVKEIVAQH
TKEWSEMINTHSAEEQEIRDLHLSQQCELLRKLLINAHEQQTQQLKMSHDRESKEMRAHQ
AKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSKEMDQLKKVQ
LEHLEFLEKQNEQLLKSCHAVSQTQGEGDAADGEVGSRDGPQASNSSVKLQNSN
Download sequence
Identical sequences M3Y4X5
XP_012911058.1.14098 ENSMPUP00000006376 ENSMPUP00000006376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]