SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012911134.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012911134.1.14098
Domain Number 1 Region: 388-484
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.25e-24
Family PWWP domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012911134.1.14098
Sequence length 494
Comment PREDICTED: PWWP domain-containing protein 2B isoform X4 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MQLGTGPPPAPCRDPAPETSGPKPPPPLVPPFPPYFEGAPFPPPLWLRSTYRQWVPQPPP
RAIKRTRRRLSRNREPGRLALSPIRLRPRQVLCEKCKSTLSPPEAGPGPPAAPQPRRRAG
SVPGPDTEPRKLADPEGGGDSAASATRRSKREKRQEGKARVPRSPAIKISYSTPQGTGEV
VEIPSRVHGSLEPFCPSQAHGGGQDPAGPPASIPKLKLTRPGPPGTGLPPPKIRLKPRPR
GAGEREPVYRAELVEVLNGHGRGPRASSPARLGHGSAGRGPVDSSSGSSGEDEDFKPCAQ
ARRGREGLAFLATCPERGPGCAGESVWSSDSPDESRSSSSEVTFPDTCDLSSGDGASVRS
SSKHARQTVPPLTVRLHTQSVSTCVTGDGRTVAVGDIVWGKIHGFPWWPARVLDLSLSQK
EDGAPSWPEAKVSWFGSPTTSFLSTSKLSPFSEFFKLRFNRKKKGMYRKAITEAANAAQH
VAPEIRELLTQFET
Download sequence
Identical sequences M3Z6B0
ENSMPUP00000019123 XP_012911134.1.14098 ENSMPUP00000019123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]