SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012912148.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012912148.1.14098
Domain Number 1 Region: 388-613
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.7e-33
Family Calponin-homology domain, CH-domain 0.00039
Further Details:      
 
Domain Number 2 Region: 85-242,380-462
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.66e-23
Family FAD/NAD-linked reductases, N-terminal and central domains 0.086
Further Details:      
 
Domain Number 3 Region: 727-758
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000371
Family LIM domain 0.0015
Further Details:      
 
Domain Number 4 Region: 694-726
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000494
Family LIM domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012912148.1.14098
Sequence length 1076
Comment PREDICTED: protein-methionine sulfoxide oxidase MICAL1 isoform X2 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MAEPASTNPAHAHFESFLQAQLCQDVLSSFRGLCEALGVEPGGGLPQYHKIKAQLNYWSA
KSLWAKLDKRAGQPVYQQGRACPNTKCLVVGAGPCGLRAAVELALLGARVVLVEKRTKFS
RHNVLHLWPFTIHDLRALGAKKFYGRFCTGTLDHISIRQLQLLLLKVVLLLGVEIHWGVT
FTGLQPPPKKGIGWRAQLQPNPPAQLASYEFDVLISAAGGKFVPEGFTVREMRGKLAIGI
TVNFVNGRTVEETQVPEISGVARIYNQSFFQSLLKATGIDLENIVYYKDDTHYFVMTAKK
QCLLRLGVLRQDWPEIDRLLGSANVVPEALQSFVRAAADFATHGKLGKLEFARDAHGRPD
ISAFDFTSMMRAESAARVQEKHGARLLLGLVGDCLVEPFWPLGTGVARGFLAAFDAAWMV
KRWAEGAGPLEVLAERESLYQLLSQTSPENMHRNVAQYALDPATRYPTLNLRAVTPNQVR
DLYDVVAKEPVRRNSDKTDTGKLAAGSAGTQEELLRWCQEQTAGYPGVHVTDLSSSWADG
RALCALVHRLRPGLLEPSELQGLGALEATAWALKMAEHELGITPVVSAKAVVAGSDPLGL
IAYLSHFHSTFKNVPHNLGGLDGPASQGFPGSSSAVLFLGKLQRTLQRTRAQENGEDTGG
KKPRLEVEAKSPSTEEPPAPESGVPPTPPSQPQEAGAGDLCALCGEQLYILERLCADGRF
FHRNCFRCRTCEATLRPGDYGQHPGDGYFYCFQHLPQPGHKDGPDPGPKSQDLPTPDENS
MPSGPSTSVIPQEGTSPVPNPSQPTRRLIRLSSPERQRLSSLKLTPDPELEPPPKPPRSC
SALARQALEGSFVGWGIPVQSPQVVVAMKEEQEQSPPSSEEEEEEEEAEETMALDSDTQE
ALLTFAKNSGTMSKYPTWRRTLLRHAREEEMKRFCKAQAVQRRLHEIETAVGELEAEGTK
VEQALRSQSTSPEQQKAQWLEQLLQLVQKKNSLLAEEAELMLTVKLLSLEEQQCEVDQEL
RGYMNLEEALKTPADRQAEEQLLKKLLDVVERRDEIVRFQEERRLSELASRLGAQR
Download sequence
Identical sequences M3YF09
ENSMPUP00000009916 XP_012912148.1.14098 XP_012912149.1.14098 XP_012912150.1.14098 ENSMPUP00000009916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]