SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012915351.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012915351.1.14098
Domain Number 1 Region: 12-82
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000028
Family HtrA-like serine proteases 0.033
Further Details:      
 
Domain Number 2 Region: 94-181
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000114
Family HtrA-like serine proteases 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012915351.1.14098
Sequence length 467
Comment PREDICTED: Golgi reassembly-stacking protein 1 isoform X2 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MGLGASAEQPAGGAEGFHLHGVQENSPAQQAGLEPYFDFIITIGHSRLNKENDTLKALLK
ANVERPVKLEVFNMKTMKVREVEVVPSNMWGGQGLLGASVRFCNFRRASEHVWHVLDVEP
SSPASLAGLRPYTDYVVGSDQILQESEDFFTLIESHEGKPLKLMVYNSESDSCREVTVTP
NAAWGGEGSLGCGIGYGYLHRIPTQPPSHHKKPPDTPPPDAPPPDAPPPDVSPSGAPPPG
APPPDAPPPDTLLPDAPPPGPTPQDSPASSGLETGSRQDDYMEALLQAPSSFMEGQFSEP
GSPSCGAPDLGGFPHPMETPLQPPPPVQRVMDPGFLDVSGISLLDSSNASVWPGLPSATE
LTSTGLSASGPEDVSSSGSHERGGEATWSGSEFEVSFPDSPGTQAQPDHLPQLTLPDSLI
SAASPEDGLSAELLEAQAEDEPASTESPEFGAEAEGAGGQALFSTPE
Download sequence
Identical sequences M3XTR7
ENSMPUP00000002467 XP_012915351.1.14098 ENSMPUP00000002467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]