SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012915427.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012915427.1.14098
Domain Number 1 Region: 361-381,444-499
Classification Level Classification E-value
Superfamily SH3-domain 8.93e-24
Family SH3-domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012915427.1.14098
Sequence length 500
Comment PREDICTED: src substrate cortactin isoform X3 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MWKASAGHAVSITQDDVGSDDWETDPDFVNDVSEKEQRWGAKTVKGSGHQEHINIHKLRE
NVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRG
FGGKFGVQVDRVDQSAVGFEYQGKTEKHASQRDYSSGFGGKYGVQADRVDKSAVGFDYQG
KTEKHESQKDYSKGFGGKYGIDRDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQT
DRQDKCALGWDHQEKLQLHESQKDYSKGFGGKYGVQTDRMDKNASTFDDVAQVAPAYQKT
VPVEAVNSRTSNIRANFENLAKEKEQEDRRKAEAERAQRLAKERQEQEEARRQLHEQAQK
PTPPASPTPQPAQERPPPSPVYEDAASFRAEPEPMYSMEAAGYQEASSQQGPAYASDAVY
EATEAPGHYQTEENTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWW
RGLCRGRYGLFPANYVELRP
Download sequence
Identical sequences M3Y055
ENSMPUP00000004706 ENSMPUP00000004706 XP_012915427.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]