SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012915473.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012915473.1.14098
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily DEATH domain 8.48e-32
Family DEATH domain, DD 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012915473.1.14098
Sequence length 216
Comment PREDICTED: FAS-associated death domain protein [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MDPFLVLLHSVSTGLSDDELTELKFLCRARVGKRKLESVRCGLDLFAVLLEQNELDAERP
ELLRELLASLRRHDLLRRLDAFEAGAAGRAPPEEPDLRAAFDIVCDNVGRDWRRLARHLH
VTDTKIDAIEEKYPRNLTEQVRESLRVWKSAEREDATVSHLVRALRACQLNLVADLVLED
QQARENETAGSGGGDKSPAESLTSWDSNGPALGGPW
Download sequence
Identical sequences M3Y014
ENSMPUP00000004665 XP_012915473.1.14098 ENSMPUP00000004665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]