SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012916465.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012916465.1.14098
Domain Number 1 Region: 294-403
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.32e-23
Family PWWP domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012916465.1.14098
Sequence length 624
Comment PREDICTED: zinc finger CW-type PWWP domain protein 1 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MTSLQSKEACGKGPKKTFAPPAPKLHSLMCYSPKPPKEDTVGISSPKARLEKKEEKATTE
NGPSSGQENKGKPQDKQVEKKEKERSSLTSAEFEEIVQIVLRKSLQECLETSCAQPIRCT
QLDKEPGIASSTENDKADGERVMAPHILEISATKEAGVSSVIKMSKPGQPDPVPSEKKFN
RTSLSKRKKGAQDDKMEKAQNTHEQRQKDQLKKPVQDDSQTRNQQKGEGSGFGQCLVWVQ
CSSPNCEKWRRLCGNVDPSVLPDNWSCDQNTDSRYNRCDIPEECWTGRESDVAYASYIPG
SIIWAKQYGYPWWPGMVESDPDLGEYFLFASHLDSLPSKYHVTFFGETVSRAWIPVNMLK
NFQELSLELARMKKCRNKDCNQKLGAALTMAQEAEQISIQERVNLFGFRSRYNGSDRSGE
GKDLRLSGANSPDSCLGKEEEDSELEAEELEEEEEKKDPTLPSPKPAKIQTKKPKARGLA
NGRDGTLQKKTMKRSLGNESAAPPVSIIGRKEGHGKSEPDQPGLKKKFKAPQSKASGTSL
SEDQEARMVPKDLTPPAHRGACPVVGKEGRKCPQEAGSVTPDDDASSDLDLEQFLEDVGT
EPEQLEEPWCGDAAGDFTLAFFEE
Download sequence
Identical sequences M3YW51
XP_012916465.1.14098 ENSMPUP00000015561 ENSMPUP00000015561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]