SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012917452.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012917452.1.14098
Domain Number 1 Region: 547-815
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-81
Family Protein kinases, catalytic subunit 0.00000108
Further Details:      
 
Domain Number 2 Region: 12-281
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.71e-52
Family FCH domain 0.016
Further Details:      
 
Domain Number 3 Region: 438-576
Classification Level Classification E-value
Superfamily SH2 domain 9.42e-28
Family SH2 domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012917452.1.14098
Sequence length 820
Comment PREDICTED: tyrosine-protein kinase Fes/Fps [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MGFSSELCSAQGHGALQQMQEAELRLLEGMRKWMAQRVKSDREYAGLLHHMSLQDSGGRG
MSPNSPISQSWAEITSQTEGLSRLLRQHAEDLNSGPLSKLGLLIRERQQLRKTYSEQWQQ
LQQDLTKAHSQDIEKLKSQYRVLARDSAQARRKYQEASKDKDRDKAKDKYVRSLWKLFAH
HNRYVLGVRAAQLHHQHHHQLLLPGLLQSLQDLHQEMACILKEILQEYLEISSLVQDEVA
AIHLEMAAAVARIQPETEYQGFLRQYGSTPDIPPCVTFDESLLEEGELLAAGELQLNELT
VESVQHTLTSVTDELAAATETVLSRQEAVTQLQRDLWNEEQNTHPRERVQLLAKKQVLQE
ALQGLQVALCSQAKLQAQQELLQAKLEQLGPGEPPPVLLLQDDRHSTSSSEQEREGGRTP
TLEILKSHISGIFRPKFSLPPPLQLVPEVQKPLHEQLWYHGAIPRAEVAELLTHSGDFLV
RESQGKQEYVLSVLWDGQPRHFIIQSTDNLYRLEGDGFPSIPLLIDHLLRSQQPLTKKSG
IVLNRAVPKDKWVLNHEDLVLGEQIGRGNFGEVFSGRLRADNTLVAVKSCRETLPPDLKA
KFLQEARILKQYNHPNIVRLIGVCTQKQPIYIVMELVQGGDFLTFLRTEGSRLRMKTLLQ
MVGDAAAGMEYLESKCCIHRDLAARNCLVTEKNVLKISDFGMSREEADGIYAASGGLRQV
PVKWTAPEALNYGRYSSESDVWSFGILLWETFSLGAPPYPNLSNQQTREFVEKGGRLPCP
ELCPDAVFRLMEQCWAYEPAERPGFSAISQELQSIRKRHR
Download sequence
Identical sequences M3YW42
ENSMPUP00000015552 XP_012917452.1.14098 ENSMPUP00000015552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]