SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012917827.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012917827.1.14098
Domain Number 1 Region: 50-112
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.06e-17
Family LIM domain 0.0011
Further Details:      
 
Domain Number 2 Region: 231-294
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.99e-16
Family LIM domain 0.001
Further Details:      
 
Domain Number 3 Region: 173-234
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.82e-16
Family LIM domain 0.0016
Further Details:      
 
Domain Number 4 Region: 137-171
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000271
Family LIM domain 0.00044
Further Details:      
 
Domain Number 5 Region: 13-47
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000527
Family LIM domain 0.0011
Further Details:      
 
Domain Number 6 Region: 108-139
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000688
Family LIM domain 0.00097
Further Details:      
 
Weak hits

Sequence:  XP_012917827.1.14098
Domain Number - Region: 290-319
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0148
Family LIM domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012917827.1.14098
Sequence length 337
Comment PREDICTED: LIM and senescent cell antigen-like-containing domain protein 1 isoform X3 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MLGVAAGMTNSNMANALANATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEG
LFYEFEGRKYCEHDFQMLFAPCCHQCGEFIIGRVIKAMNNSWHPECFRCDLCEEVLADIG
FVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIDEQPLIFKNDPYHPDHFNCANCGKEL
TADARELKGELYCLPCHDKMGVPICGACRRPIEGRVVNAMGKQWHVEHFVCAKCEKPFLG
HRHYERKGLAYCETHYNQLFGDVCFHCNRVIEGDVVSALNKAWCVNCFACSTCNTKLTLK
NKFVEFDMKPVCKKCYEKFPLELKKRLKKLAETLGRK
Download sequence
Identical sequences M3YH73
ENSMPUP00000010680 XP_012917827.1.14098 ENSMPUP00000010680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]