SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012918201.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012918201.1.14098
Domain Number 1 Region: 485-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.41e-26
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 345-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.05e-26
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 2-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.19e-25
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 4 Region: 541-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.79e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 5 Region: 401-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.84e-24
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 289-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 587-639
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-21
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 8 Region: 251-303
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-16
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 9 Region: 448-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000515
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Weak hits

Sequence:  XP_012918201.1.14098
Domain Number - Region: 194-241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000643
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012918201.1.14098
Sequence length 647
Comment PREDICTED: zinc finger protein 567 isoform X2 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MAQASVSFKDVTVDFTREEWQHLDPAQKTLYMDVMLENYCHLISVGCHMTKPDVILKLER
GEEPWTSFTSHTCLEENWKEEDFLVKFKEHQDKFSRSVVFINHKKLTKENSNAYEKTFTL
SKNPINSKNLPPEYDTHGKFFKNVSELIISNLSPARKRLSEYHGYGKSLLNTKAETAQPG
VKSHNQRGRAISHNEVLMQYHKVETPAQSFGYNDCEKAFLKKGGLIMHNRTYRRENPSEY
NKRRRATNIEKKHTCTECGKSFCRKSVLILHQGIHTEEKPYQCHQCGNSFRRKSYLIDHQ
RTHTGEKPFVCNECGKSFRLKTALTDHQRTHTGEKSYECPQCRNAFRLKSHLIRHQRTHT
GEKPYECNDCGKSFRQKTTLSLHQRIHTGEKPYICKECGKSFHQKANLTVHQRTHTGEKP
YICNECGKSFSQKTTLALHEKTHNEEKPYICNECGKSFRQKTTLVAHQRTHTGEKSYECP
HCGKAFRMKSYLIDHHRTHTGEKPYECNECGKSFSQKTNLNLHQRIHTGEKPYICNECGK
SFRQKATLTVHQKIHTGQKSYECPQCGKAFSRKSYLIHHQRTHTGEKPYKCNECGKCFRQ
KTNLIVHQRTHTGEKPYICNECGKSFSYKRNLIVHQRTHKGENIEMQ
Download sequence
Identical sequences M3Y2L5
ENSMPUP00000005566 XP_012918201.1.14098 ENSMPUP00000005566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]