SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012918258.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012918258.1.14098
Domain Number 1 Region: 463-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.73e-24
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 2 Region: 352-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.52e-24
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 3 Region: 296-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 408-464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.35e-23
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 5 Region: 18-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.14e-20
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 6 Region: 257-309
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-17
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 135-186
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000019
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Weak hits

Sequence:  XP_012918258.1.14098
Domain Number - Region: 194-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.019
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012918258.1.14098
Sequence length 527
Comment PREDICTED: zinc finger protein 529 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MAEMEFPDQFFTVLSMDHELVTFRDVVITFSPEEWEYLDSAQRNLYWDVMMENYSNLVSL
DLDSNYDKKCLSTRKDITENSGSQCKVTESKFIGLESSIFRNDQQSKGKCEVQRSEVGYF
SQMKINSKKVPDYKSVISHQTTHDSKNPHAYKEYGKVLSCDLNFGEYERIHTGEKTYQYN
AYWKTFGDDPHTLQLKIHSGMKPCKYMESENAFSFYEDLSIQKMHDDQKCYKCKKYERTI
RRVEEMPPLQVIHDAEKPYECTFCGKSFRVHTQLTRHQKIHTDEKPYKCMECGKDFRFHS
QLTEHQRIHTGEKPYKCIQCEKVFRISSQLIEHQRIHTGEKPYACKECGKTFGVCRELAR
HQRIHTGKKPYECKACGKVFRNSSSLTRHQRIHTGEKPYKCKECGKAFGVGSELTRHQRI
HSGQKPYECKECGKFFRLTSALIQHQRIHSGEKPYECKVCGKAFRHSSALTEHQRIHTGE
KPYECKACGKAFRHSSSFTKHQRIHTGKKPYECKECGSAFSVGKHLT
Download sequence
Identical sequences M3Y2I8
ENSMPUP00000005539 XP_012918257.1.14098 XP_012918258.1.14098 XP_012918259.1.14098 XP_012918260.1.14098 XP_012918261.1.14098 XP_012918262.1.14098 ENSMPUP00000005539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]