SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012918984.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012918984.1.14098
Domain Number 1 Region: 567-631,898-1017
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.2e-43
Family Ypt/Rab-GAP domain of gyp1p 0.0056
Further Details:      
 
Domain Number 2 Region: 7-174
Classification Level Classification E-value
Superfamily RUN domain-like 5.1e-30
Family RUN domain 0.001
Further Details:      
 
Domain Number 3 Region: 994-1116
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.71e-26
Family Ypt/Rab-GAP domain of gyp1p 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012918984.1.14098
Sequence length 1124
Comment PREDICTED: small G protein signaling modulator 1 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MEEAVTRKFVHEDSSHIISFCAAVEACVLHGLRRRAAGFLRSNKIAALFMKVGKNFPPAE
ELSRKVQDLEQLIESTRNQIQGLQENVRKLPKLPNLSPLAIKHLWIRTALFEKVLDKIVH
YLVENSSKYYEKEALLMDPVDGPILASLLVGPCALEYTKMKTADHFWTDPSADELVQRHR
IHSSHLRQDSPTKRPALCIQKRHSSGSMDDRPSLSARDYVESLHQNSRATLLYGKNNVLV
QPKDDMEAVPGYLSLHQTADVMTLKWTPNQLMNGSMGDLDYEKSVYWDYAMTIRLEEIVY
LHCHQQVDSGGTVVLVSQDGIQRPPFRFPKGGHLLQFLSCLENGLLPHGQLDPPLWSQRG
KGKVFPKLRKRSPQGSAESTSSDKEDDEATDYVFRIIYPGMQSEFVAPDPLGSTVFNSVR
PAWMVVPAGRSVLVVARGGPRARTGWGTAFPRPGLMQQPPIPQDLMDVSVSNLPPLWQPS
PRKSSCSSCSQSGLVDGGSSNGCNHERAPLKLLCDNMKYQILSRAFYGWLAYCRHLSTVR
THLSALVNHMIVSPDSPCDAGCGLTARIWEQYLQDSTSYEEQELLRLIYYGGIQPEIRKA
VWPFLLGHYQFGMTEAERKEVDEQIHACYAQTMAEWLGCEAIVRQRERESHAAALAKCSS
GASLDSHLHQMMHRDSTISNESSQSCSSGRQHVRLQSDSSSGTQVFESVDEVEQVEAEGR
LEEKQPKIPNGSLANGTCSPDSGHPSSHNFSSGLSEHSEPSLSTEDSVMDAQRNTPLARR
PGDSSVDDGQSSEATTSRDEAPREELAVQDSLESDLLANESMDEFMSLTGSMDVALPGKE
GATMERWGGGEVEKHSQMDSEDNLSEEPEMESLFPPLASLAVATSANNEASPVSSSGVTY
SPELLDLYTVNLHRIEKDVQRCDRNYWYFTPANLEKLRNIMCSYIWQHIETGYVQGMCDL
LAPLLVILDDEALAFSCFTELMKRMNQNFPHGGAMDTHFANMRSLIQILDSELFELMHQN
GDYTHFYFCYRWFLLDFKRELIYDDVFSVWETIWAAKHVSSAHYVLFIALALVEVYRDII
LENNMDFTDIIKFFNEMAERHNTKHILKLARDLVYKVQTLIENK
Download sequence
Identical sequences M3YQI1
ENSMPUP00000013590 ENSMPUP00000013590 XP_012918984.1.14098 XP_012918985.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]