SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012919134.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012919134.1.14098
Domain Number 1 Region: 829-1064
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.67e-57
Family DBL homology domain (DH-domain) 0.000033
Further Details:      
 
Domain Number 2 Region: 1061-1190
Classification Level Classification E-value
Superfamily PH domain-like 7.67e-35
Family Pleckstrin-homology domain (PH domain) 0.001
Further Details:      
 
Domain Number 3 Region: 648-700
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000404
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.011
Further Details:      
 
Weak hits

Sequence:  XP_012919134.1.14098
Domain Number - Region: 136-220
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00068
Family Ankyrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012919134.1.14098
Sequence length 1703
Comment PREDICTED: rho guanine nucleotide exchange factor 28 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MELSCGEVPLYGQKTVYAKFGKNVYLPKDAEFYFIYSGSHQRHIVIAERAEDNVLQSSIP
GHGLQETVTVSVCLCSEGYSPVTMGSGSVTYVDTMACRLARLLVTQADRLTADSHQTLLT
PFALTVGALPALDEEFVLALTHLELPLEWTVLGISSLEVSLCRESLLHLAMRWGLPKLSH
FLLCLPGGVQALSLPNEEGATPLDLALQAGHSKLVEDITNFQGRRTLGFSRVQLSEQAFL
QYLHSSETLTLTLNHTAEHLLEADIKLFRKYYWDRAFLLKTLEDQEARPEERGDKPSSAA
ETEEEIKNLATSRSSPEKENVKHMENLVVQPNEHGDRDRLDLDHSSDVFKKSKHPPTFFG
VGRLSEVLNGGDEVYANCMVIDQVGDLDINYVNIEGIMTEVCPESMGSTLGPQNCKHILD
AENSHGKCPLNENKEVTSNTEAQQSPSPSSSYASKYNLSFGHRGFEKEQSHLKKRSSSLD
ALDADSEGEGRSEPARICYTPVSQSSSRTGIPSGDELDSFETTTEPDFSISRTESLSLSS
NLPLKESLLSGVRSRSYSCSSPKISLGKTRLVRDFTVCSSSEEQRAYSLPEPPREKRIQE
EEWDKYIIPAKSESEKYKVSRTFSFLMNRMTSPRNKSKTKSKDAKDKEKLSRHQFVPGTF
SGVLQCSVCDKTLLGKESFQCSNCNTNVHKGCKDAAPPCTKKFQEKYNKNKPQTILGNSS
FRDIPQPGLSLHPSSSMPIGLPTRRKEASAQAHPLSRSVPGTTLESFRRSGPSLESESDG
NTWRSRSHSDELLQSMGSSPSTESFLMEDVVDSSLWSDLSSDAQELEAESWSLVVDPSFC
SKQEKDVIKRQDVIFELMQTEMHHIQTLLIMSEIFRKGMKEELQLDHSTVDKIFPCLDEL
LEIHRHFFYSMKERRQESCAGDDRNFIINRIGDILVQQFSEENANQMKKIYGEFCSHHKE
AVSLFKELQQNKKFQNFIKLRNSNLLARRRGIPECILLVTQRITKYPVLVERILQYTKER
SEEHKDLCKALGLIKDMIAAVDLKVSEYEKNQKWLEILNKIENKTYTKLKNGHVFRKQAL
ISKERTLLHDGLVYWKTATGRFKDILALLLTDVLLFLQEKDQKYIFAAVDQKPSVISLQK
LIAREVANEERGMFLISASSAGPEMYEIHTNSKEERNNWMRRIQQAVESCPEEEGGRTSE
SDEERRKAEARVAKIQQCQEILSNQDQQICTCLEEKLHIYAELGELSGLEDVHLEPHLLI
KPDPGEPPQAASLLAAALKEAESLQVAVKATQAGDACQSSEEGSGESSLTDTRSTPEEPG
SSPASLVTEGTGGRGCWDVDPGTQGLGTDLAVSDAGEKVEYRSFPVSSQSEIIQAIQNLT
RLLYSLQAALTIQDSHIQVHRLLLQQQESLSPGPSFRGSPFQDQEKYRNLEKQREELANI
HKLQSQFQQDQRRWHRQCDQQQREQEAKASRLQERERECRSQEELLLRTRGELDQQLQEY
QQNLERLREGQRLVERERERMRAQQSLLCGWKHGRQSSLPAAFSPGSIEVMELNRSESLC
HENSFFVNEALVQMSLNPYNQSTLSGVHQDATYPQNIANSDLVRTSENQVDLQLDISQPL
DVNHELWTATGSCHQIPPLHPSSKDSCKNDLDNSQTEFPTPHDSNPPGSQLQTFMAEAKL
NLQTLTRQDGETGDGAEENIVYL
Download sequence
Identical sequences M3Y379
ENSMPUP00000005780 ENSMPUP00000005780 XP_012919131.1.14098 XP_012919132.1.14098 XP_012919133.1.14098 XP_012919134.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]