SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012919272.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012919272.1.14098
Domain Number 1 Region: 8-73
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.19e-17
Family LIM domain 0.01
Further Details:      
 
Domain Number 2 Region: 130-192
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.67e-16
Family LIM domain 0.0046
Further Details:      
 
Domain Number 3 Region: 189-255
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000199
Family LIM domain 0.0048
Further Details:      
 
Domain Number 4 Region: 69-133
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000196
Family LIM domain 0.0071
Further Details:      
 
Domain Number 5 Region: 251-278
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000256
Family LIM domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012919272.1.14098
Sequence length 284
Comment PREDICTED: four and a half LIM domains protein 5 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MTTAQFDCQYCTASLLGKKYVLKNDNPYCVSCYDRIFSNYCEECKEPIESGSKDLGYKGR
HWHEACFNCAKCNHSLVEKPFAAKDERLLCSECYSNECSCKCFHCKRTIMPGSRKMEFKG
NYWHETCFVCEHCRQPIGTKPLISKESGNYCVPCFEKAFAHYCSFCKKVITSGGITFHDQ
PWHKECFLCSSCRKELCEEEFMSRDDYPFCLDCYNHLYAKKCAACTKSITGLRGAKFICF
QDRQWHSECFNCGKCSVSLVGEGFLTQNKEIFCRKCGSGLETDI
Download sequence
Identical sequences M3XQV9
XP_004767121.1.14098 XP_004767122.1.14098 XP_004767123.1.14098 XP_004767124.1.14098 XP_004767125.1.14098 XP_012919272.1.14098 XP_012919273.1.14098 ENSMPUP00000001459 ENSMPUP00000001459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]