SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012920873.1.39548 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012920873.1.39548
Domain Number 1 Region: 2212-2305
Classification Level Classification E-value
Superfamily C-type lectin-like 1.37e-30
Family Link domain 0.00012
Further Details:      
 
Domain Number 2 Region: 511-650
Classification Level Classification E-value
Superfamily FAS1 domain 3.79e-27
Family FAS1 domain 0.0021
Further Details:      
 
Domain Number 3 Region: 1476-1524,1602-1716
Classification Level Classification E-value
Superfamily FAS1 domain 9.03e-27
Family FAS1 domain 0.0024
Further Details:      
 
Domain Number 4 Region: 1717-1871
Classification Level Classification E-value
Superfamily FAS1 domain 1.18e-25
Family FAS1 domain 0.0057
Further Details:      
 
Domain Number 5 Region: 968-1125
Classification Level Classification E-value
Superfamily FAS1 domain 5.36e-22
Family FAS1 domain 0.0054
Further Details:      
 
Domain Number 6 Region: 386-501
Classification Level Classification E-value
Superfamily FAS1 domain 4.45e-18
Family FAS1 domain 0.0064
Further Details:      
 
Domain Number 7 Region: 2303-2465
Classification Level Classification E-value
Superfamily FAS1 domain 7.46e-17
Family FAS1 domain 0.011
Further Details:      
 
Domain Number 8 Region: 1134-1243
Classification Level Classification E-value
Superfamily FAS1 domain 0.00000011
Family FAS1 domain 0.007
Further Details:      
 
Domain Number 9 Region: 1548-1585
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000377
Family Merozoite surface protein 1 (MSP-1) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012920873.1.39548
Sequence length 2583
Comment PREDICTED: stabilin-1 isoform X1 [Heterocephalus glaber]; AA=GCF_000247695.1; RF=representative genome; TAX=10181; STAX=10181; NAME=Heterocephalus glaber; AL=Scaffold; RT=Major
Sequence
MAEPLGHLLLCLLAFWLSGSSFILGQKVQSKRCDVKTKFITHVPCTSCAIKRQMCPSGWL
LQHFPDKISQSCRYEVHLGDSLVSMSGCSVECWKDVVQKACCPGYWGSQCYECPGGAKTP
CNGHGTCLDGMAGNGTCMCLENFSGSACQECRDPRRFGADCQSECSCVHGMCSNGPQGDG
RCLCFAGYTGPRCDQELPVCRNLNCPLNSRCSAEAPACECLSGYIQRGSRCVARDPCQPS
PCSPLARCSVSPEGRAQCHCPENYHGDGKVCLPQDPCAINLGGCPRNSTMCLYQKPGKAT
CSCQPGLVSINRNASAGCFAYCFPHTCDKSATCQVTPEGRTSCLCKEGEVGDGRACYGHL
LHEVQKANEMGTLFQRLRVAIAMLEQGCQEILTTSGPFTVLVPTATSASALSVSKNMNAL
LARQLCQQHVIAGQHILEDGLSQSTRTWWTLAGQEITVLFNTVRYTYKYSDQPHQTFTVQ
KANNIASNGVFHVVTSLRWQPLPALPGSPKQTVGQILASNEVFSRFETILENCGLPSILD
GPGPFTVFAPSNEAVDSLRDGRLIYLFTAGLSKLQELVRFHIYSRGQMTIAKLISKGRIF
TMANQVLAVNISDEGRILLGPEGIPLRLMDVLAANGVIHMLEGILLPPTILPILPKHCGE
EQHKIVVGSCVDCQALNTSVCPPNSVKLDILPKECIYTHDSVGLNVLKKGCAQYCNQTIT
KLGCCKGFFGPDCTQCPGGFSNPCYGKGNCSDGIRGNGACLCFPDYKGIACHICSNPNKH
GDQCQEDCGCIHGLCDNRPGSAGVCQQGTCVPGFRGRFCNETVRDCGPTGLAQHCHQHAR
CLSQEGVTRCVCLDGFEGDGYSCTRHNPCSQPDRGGCSENAECVPGDLGTHHCTCHKGWS
GDGRVCVAIDECGLDTRGGCHAEALCSYVGPGQSRCTCKLGFAGDGYECSPIDPCRAGNG
GCHGLATCKAVGAGQRVCTCPPHFGGDGFNCYGDIFRELEANAYFSTFYQWFKSSGITLS
ADSRVTALVPSESAVRWLSPEDKAFWLQPKMLPALVRAHFLQGALSEEDLARLGGQEVAT
LSPTTRWEIRNISGRVWVQNASMEVADLLATDGVLHIINQVLLPPRGDVQVGQGVLQQLD
QVPAFRLFRELVQHHRLVPQIEAATAYTIFVPTNQSLEVQGNSSSLDADTVRHHVILGEA
LSVEALQRGGHRNSMLGPAHWLVFYNHSGQPEVNHMPLEGPLLEGPGYSLFGLSGVLTVG
SSRCLHSHAEALREKCINCTRKFRCTQGFQLQKTPKKSCVYRSGLSFSRGCAYTCVKKIQ
VPDCCPGYFGTLCEPCPGGRGGVCSGHGQCQDGLLGNGECRCREGFHGAACEMCELGRYG
PDCAGVCGCAQGLCQEGLRGDGSCVCNVGWQGLRCDQKISSPQCAKKCDPNANCIQSSAA
APACVCAAGYSGNGSHCSEVDPCAHGHGGCSPYANCTKVAPGQRTCICQDGYTGDGELCQ
EVNGCLVHNGGCHVHAECIPTGPQQVSCSCREGYSGDGIRACELLDPCSKNNGGCSPYAV
CKSTGDGQRTCTCDRARTVGDGFTCRARVGLELLRDKQASFFSLHLLEYKELKGEGPFTI
FVPQADLMTNLSQDELARIRAHRQLVFRYHVVGCRQLQSQELLDQGYATALSGHSLRFSE
REGSIYLNDFARVVSSDHEAVNGVLHFIDRVLLPPDALHWEPDAITVPRRNVTTAAESFG
YKIFSRLVKVAGLLPMLQDVSHRPLTMLWPTDSALQALPLDRQAWLYHEDHRDKLAAILR
GHVIRNVEALASDLPKLGPLRTMHGTPISFSCGRGRPGELMVGEDDARIVQRYLAFEGGL
AYGIDQLLEPPGLGARCDGFETRPLRLKACSICGLEPPCPEGSREQGSPEACWRYYSKFW
TNPAQRAFILGSAWVRPSFWGQPQGLGRGCQRSCVTTTWKPNCCPGHYGSECQACPGGPS
SPCSDHGVCLDGMSGSGQCRCHSGFAGTACELCSPGAFGPQCQACRCTPRGRCDEGLGGS
GSCFCDEGWTGPRCEVQLELQPVCTPPCAPQAMCRVGNSCECSLGYEGDGRVCTVADLCQ
DGHGGCSKHANCSQAGTVVTCACLPDYEGDGWSCRARDPCADSRRGGCSEHAACLFTGPN
TRRCECHAGYVGDGLQCLEEAEPPVDRCLGRPSPCHSDAVCTDLHFQEKRAGVFHLQALS
GPYGLSFSEAEAACGAQGAALASLLQLSAAQQLGFHLCLMGWLANGSAAHPVVFPAADCG
DGRVGVVSLGTRKNLSERWDAYCFRVQDVACRCRDGLVGDGISMCNGKLLDVLAATANFS
TFYGMLLDYANATKRGLDFLDFLDDELTYKTLFVPVNEAFVGNLTLSGPDLELHASNTTF
LSTNVSRGTLLPAHSGLSLVISDGGPDNSSWAPVPPGTVVVRHVIVWDIIAFNGIIHALA
SPLLTPPQAVSLGEKQHSQQQGAPESRPVAASVGAVGATGALLSLVAGALYLRARGKPTG
FGFSTFQAEDAAADDFSPWQEGTPTLVSVPNPVFGTHDAFCEPFDDSLLEDDFPDTQRIL
AVK
Download sequence
Identical sequences XP_012920873.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]