SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012923163.1.39548 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012923163.1.39548
Domain Number 1 Region: 31-522
Classification Level Classification E-value
Superfamily Sema domain 6.8e-94
Family Sema domain 0.002
Further Details:      
 
Domain Number 2 Region: 1386-1510,1676-1857
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.8e-33
Family p120GAP domain-like 0.023
Further Details:      
 
Domain Number 3 Region: 954-1044
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000028
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.039
Further Details:      
 
Domain Number 4 Region: 863-955
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000528
Family Other IPT/TIG domains 0.016
Further Details:      
 
Domain Number 5 Region: 1042-1129
Classification Level Classification E-value
Superfamily E set domains 0.0000000000172
Family E-set domains of sugar-utilizing enzymes 0.055
Further Details:      
 
Domain Number 6 Region: 525-577
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000085
Family Plexin repeat 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012923163.1.39548
Sequence length 1900
Comment PREDICTED: plexin-D1, partial [Heterocephalus glaber]; AA=GCF_000247695.1; RF=representative genome; TAX=10181; STAX=10181; NAME=Heterocephalus glaber; AL=Scaffold; RT=Major
Sequence
SPPSSRAGLARPGALLLLLLLAAPARGLEVQRRFASPTPTNNFALDGASGTVYLAAVNRL
YQLSGGDLSLQDEAAVGPVRDSPLCHAPQLPQASCEHPRRLTDNHNKILQLDERQGLVVA
CGSVFQGFCQLRRRGNISALAVRFPPAAPPAAPVAVFPSMLNVAANHADASTVALVLPPA
AGARGSRLLVGATYTGFGSAFFPRNRSLEDHRFENTPEVAIRSLDAQGDPARLFTFDLNP
SDDNVLKIKQGAKERHRLRFVRAFLHPPGVQPYAYLAFTSEARAGDKDGQARSLLARICL
PRGDAKKLTESYIELGLQCAGGAGRGDLYSRLVSVFPARERLFGVFERPPAIPAPRTAPA
PAALCAFLFADVQAAIRSARAACFVEPAAGVVAVLDSVVQGTGPACERKRNLQLQPEQLD
CGAAHLQHPLTILQPLKATPVFRAPGLTAVAVASANNYMAVFLGTATGRLLKLSLNESMQ
VVSRRMVTVAYGEPVHPIMQFDPTDPSYLYLMTSHQMARVKVAACEAHATCGDCVGAADA
YCGWCVLETRCTMQQDCDNSSQPHFWTSASEGPSRCPAMAVLPAEIDVHLEHPGMILQVS
GSLPSLSGLEMACDYGNGIHTVARVPGPADGHQITYCNLLPRDHFPAFPPQQDHVTVEMS
LRVHGRAIVSANFTIYDCSRVAHVAPSTACTSCLSARWPCFWCTEQHICISNQSQCQASS
NPKSPRDCPQTLPSPLAPAPTGGAQDILVPLANAASFHGAVLQCSFGLEDNFEAVWVNES
AIRCSHVVLHTAQKSQMFLLSLQLQGQPPRFLDSPDPMTVVVYNCAMGSPDCSQCLGRED
LGHLCMWSDGCRSRGPLPPPPGTCPAPEIHTIEPLSGPLDGGTLLTIRGRDLGRRLSDVA
HSVWIGSVACELLANRYIVSEEIVCVTGPATAAFSDVVTVNMSKEGTSRERFSYVLPQVH
SLEPAVGPTAGGTRITIHGSDLHVGSKLQVLVNDTDPCTELVRSDTSIACTMPAGALPAP
VPVCVRFERRGCAHGNLSFTYMRNPVIMAISPRRSPVSGGRTITVAGERFHMVQNVSMAV
HRIGREPTLCKVLNATLITCPSPGALHNASAPVAFFINGRVYVDEAPYEPLPDPEEMPRG
GRFHLDYLPNPQFSTARRERWIRHHPGEPLTLVIHKEQDGLGLESHEYQVKIGQVACDIQ
IVSDRVIHCSVNDSLDAAEGQLPITVQVGNFNQTIATLQLGGSETTIVASIVIFSVLLLL
SVVALFFFCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQG
IPFLEYKHFVTRTFFPKCSSLYEERYMLPLQSLGSKGGLPVQETHPLLGEWNVPENCRPS
MEEGISLFSSLLSNKHFLIIFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTSIMKE
LLVDLIDASAAKNPKLMLRRTESVVEKMLTNWMSICMYSCLRETVGEPFFLLLCAIKQQI
NKGSIDAITGKARYTLNEEWLLRENIEAKPRNLNVSFQGCGMDSLSVRAMDTDTLTQVKE
KILEAFCKNVPYSQWPRAEDVDLEWFATSTQSYILRDLDDTSVVEDGRKKLNTLAHYKIP
EGASLAMSLTDKKDNTLGRVKDLDTEKYFHLVLPTDELAEPKKSHRQSHRKKVLPEIYLT
RLLSTKGTLQKFLDDLFKAILSIREDKPPLAVKYFFDFLEEQAEKRGISDPDTLHIWKTN
SLPLRFWVNILKNPQFVFDIEKTDHIDACLTVIAQAFIDACSISDLQLGKDSPTNKLLYA
KEIPEYRKVVQRYYKQIQDMAPLSEQEMNAHLAEESRKYQNEFNTNVALAEVYKYAKRYR
PQIVTALEANPTARRTQLQHKFEQVVALMEDNIYECYSEA
Download sequence
Identical sequences XP_012923163.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]