SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012930789.1.39548 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012930789.1.39548
Domain Number 1 Region: 2-228
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.66e-54
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0038
Further Details:      
 
Domain Number 2 Region: 310-484
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000000121
Family FAD/NAD-linked reductases, N-terminal and central domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012930789.1.39548
Sequence length 532
Comment PREDICTED: dimethylaniline monooxygenase [N-oxide-forming] 3 [Heterocephalus glaber]; AA=GCF_000247695.1; RF=representative genome; TAX=10181; STAX=10181; NAME=Heterocephalus glaber; AL=Scaffold; RT=Major
Sequence
MVRRVAIIGAGVSGLASIRSCLEEGLEPTCFERSNDIGGLWKFSDHVEEGRASIYKSVFT
NSSKEMMCFPDVPFPDDFPNFMYHGKLQEYIIAFAREKDLLKYIQFETLITSIIKRPDFS
ITGQWDVTTEKDGKKASAVFDAVMICSGHHVYPNIPKESFPGLKDFKGQCFHSRDYKEPG
TWKGKRVLVIGLGNSGCDIAAELSHTAEQVMVSSRSGSWVMSRVWDDGYPWDMVFVTRFQ
TFLKNSLPTAVSDWWYVKQMNARFKHENYGLMPLNGTLRKEPVFNDELPARILCGTVSIK
PNVKKFTETTAIFEDGTMFEKIDCVIFATGYGYAYPFLDESIIRSRNNEVTLFKGIFPPQ
LEKSTLAVIGLVQSLGAAIPTTDLQARYAAQVVKGTCVLPPVKDMMDDIDEKMGKKRKLF
GKSETIQTDYIDYMDELASFIGAKPNILWLFLTDPKLAVEVFFGPCSPYQFRLVGPGKWP
GARNAILTQWDRTLKPTSTRIVGDLLKPSVFFHLFKLLAIPILFIALFLMLI
Download sequence
Identical sequences G5BGT6
XP_004853513.1.39548 XP_004853514.1.39548 XP_004853515.1.39548 XP_012930789.1.39548 HGL_H00000356729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]