SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012932989.1.39548 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012932989.1.39548
Domain Number 1 Region: 57-170
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-28
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 2 Region: 265-379
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000249
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 3 Region: 468-505
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000537
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 178-215
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000128
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 224-263
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000115
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 429-466
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000249
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012932989.1.39548
Sequence length 783
Comment PREDICTED: low-density lipoprotein receptor-related protein 3 isoform X1 [Heterocephalus glaber]; AA=GCF_000247695.1; RF=representative genome; TAX=10181; STAX=10181; NAME=Heterocephalus glaber; AL=Scaffold; RT=Major
Sequence
MKSLAPGHGYLWLDLISLWGRPVLKPWGRGQAVPPSTCFPPEGGACISQPPLLTAACSGK
LEQHTERRGVIYSPAWPLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQCSLDWLLL
GPAAPPRQEAFRLCGSAIPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRGKLGQVSC
QADEFRCDNGKCLPGPWQCNTVDECGDGSDEGNCSAPASEPPGSLCPGGTFPCSGARSTR
CLPVERRCDGTQDCGDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLV
DTQDPRRVLLQLELRLGYDDYVQVYEGLGERGDRLLQTLSYHSNHRPVSLEAAQGRLTVA
YHARARSAGHGFNATYQVKGYCLPWEQPCGSSSEGDSGSSGDQGCFSEPQRCDGWWHCAS
GRDEQGCPACPPDQYPCEGGSGLCYAPADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNL
CIFETWRCDGQEDCQDGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLR
TQEYRAFETQMTRLEAEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQVSVLQNLRTAM
RRQMRRHASRRGPSRRRLGRLWNRLFHRPRAPRGQIPLLTAARTSQTVLGDGLLQPGPGA
TPGPSAPPTDAGSPRAPGDGPPSAPGHTLELGPSVPLPSGLQDPEYRPMDRDRKACRDPL
VDNLATVDTAPEPRSAQDPQPQVPTASSTQGPHSAEPLGGCRSPLPPCSPMLEASDDEAL
LVC
Download sequence
Identical sequences XP_012932989.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]