SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012952122.1.99704 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012952122.1.99704
Domain Number 1 Region: 279-376
Classification Level Classification E-value
Superfamily Immunoglobulin 3.35e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 440-730
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 4.84e-17
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.044
Further Details:      
 
Domain Number 3 Region: 201-292
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000197
Family V set domains (antibody variable domain-like) 0.081
Further Details:      
 
Domain Number 4 Region: 26-78
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000804
Family Ovomucoid domain III-like 0.0097
Further Details:      
 
Domain Number 5 Region: 110-192
Classification Level Classification E-value
Superfamily EF-hand 0.000000000157
Family Calmodulin-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012952122.1.99704
Sequence length 792
Comment PREDICTED: follistatin-related protein 5 isoform X7 [Anas platyrhynchos]; AA=GCF_000355885.1; RF=representative genome; TAX=8839; STAX=8839; NAME=Anas platyrhynchos; breed=Pekin duck; AL=Scaffold; RT=Major
Sequence
MGQDGHLGSCENKYCGLGRHCVVNGESGQAECVCMERCKLHYKPVCGSDGEFYENHCEVH
RAACLKKQKVTIVHNEDCFFKGDKCKPTEYTKVKNMLLDLQSRRYVAQSEDKHVDEKMAL
KKILVDQMFNYFDSDSNGLVDTNELSQVIKRDELGKDLSDCSLFDLLKYDDYNSDKHLGL
EEFYRAFQVIQLSLPEDQKLSITAATVGQSAVLSCAIQGTLRPPIIWKRNNVILNNLDLE
DINDFGDDGSLYITKVTTTHMGNYTCYADGYDKLFQTHILQVNVPPVIRVYPESQAREPG
VTASLRCHAEGIPNPQLGWLKNGIDITPKLSKQLTLQANGSEVHISNVRYEDTGAYTCIA
KNEAGVDEDISSLFVEDSARKTLANILWREQGLGIGNMFYVFYEDGIKVIQPVECEFQRH
IKPSEKLLGFQDEVCPKADGDPVQRCVWATAVNVKDKFIYVTQPTLNRVLIVDVQSQKVV
QAVSTDPVPVKLHYDKSHDQVWVLSWGDMEKNSPTLQVITQASGSVSHHTIHTQPVGKQF
DRVDDFFIPATTLIITHIRFGFILHKDEAVLQKIDLETMSYIKTISLKDYNCIPQSLAYT
HLGGFIFIHCKPDTTGAVLPQLIVDSVTDSVIGCNGDVTGTPHVSPDGHYLVSIDDTKGL
MRFQYITMRGEIQDAFDIHTNLHISDVAFQPSFTEAHQYNVYCSSSTQTDVLFVELSSGK
VKMVKSLKEPVKAGEWPWNSKNRLIKDSGLFGQYLMTPSKESLFILDGRLNKLNCEITEV
ERGNTVIWVGEA
Download sequence
Identical sequences XP_012952122.1.99704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]