SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012998760.1.53824 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012998760.1.53824
Domain Number 1 Region: 525-582
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.94e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 581-638
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.63e-20
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 3 Region: 301-358
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.33e-20
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 4 Region: 245-302
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-19
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 413-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-19
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 6 Region: 469-526
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-19
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 189-246
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.61e-19
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 8 Region: 357-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-18
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 9 Region: 37-83
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.63e-18
Family KRAB domain (Kruppel-associated box) 0.00087
Further Details:      
 
Domain Number 10 Region: 637-694
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.76e-17
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 11 Region: 679-731
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.62e-17
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 12 Region: 137-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000152
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012998760.1.53824
Sequence length 741
Comment PREDICTED: zinc finger protein 709-like isoform X1 [Cavia porcellus]; AA=GCF_000151735.1; RF=representative genome; TAX=10141; STAX=10141; NAME=Cavia porcellus; strain=inbred line 2N; AL=Scaffold; RT=Major
Sequence
MTPAAHSAIFETPCCPHTWAEEGLEETLSLELGRAAFMQAVTFEDVAVNFTSEEWALLNS
SQKKLYRDVMEETFRNMVAIRRTGDNQEVEKECKTYWRYLRNEETGKCYQLKAWNQYKEL
FLHTSDAKMNVKQTDTHSAVQIHETNCSGGKAYVCKQCGKTFATRGYCKIHESLHTGEKP
YACKQCGKAFSTRRYCHMHERLHTGEKPYVCKQCGKAFSMKRHCQIHERTHTGEKLHVCK
QCGKAFTTRGYCKVHERIHTGEKPYVCKHCGKAYSRYSECKIHERNHTGEKPYACKQCEK
AFTTRRSCQIHERIHTGEKAYVCKQCGKAFTSQSYCQIHERLHFGEKPYVCKQCGKAFTT
HGSCQIHERTHTGEKPYICKQCGKAFSTRRYCHIHERLHTGERHYVCKQCGKAFRTRIYC
KKHERLHTGEKPYVCKQCGKAFSTRKYCQRHERCHSGEKPYVCKQCGKAFSRNTHCQKHE
RIHIGEKPYVCKQCGKGFTTHGYCQIHERSHTGEKPYVCKHCGKAFSRYSECKIHEKSHT
GEQPHVCKQCGKAFSRQSEYKIHERIHTGEKPYACKQCGKAFTTHRSCQVHERIHTGEKP
YVCKQCGKAFSTNSHCQRHEKIHTGVKPYVCKQCKKAFTTHRSCQIHERNHTGNKAYVCK
HCGKAFTTHGYCKIHERLHIGEKPYVCKQCGKAFSTRRYCQLHERCHTGEKPYVCKQCGK
AFSRNTHCRRHESIHMERNSV
Download sequence
Identical sequences XP_012998760.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]