SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012999338.1.53824 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012999338.1.53824
Domain Number 1 Region: 2219-2312
Classification Level Classification E-value
Superfamily C-type lectin-like 4.71e-32
Family Link domain 0.00013
Further Details:      
 
Domain Number 2 Region: 519-657
Classification Level Classification E-value
Superfamily FAS1 domain 1.22e-28
Family FAS1 domain 0.0017
Further Details:      
 
Domain Number 3 Region: 1483-1531,1609-1723
Classification Level Classification E-value
Superfamily FAS1 domain 1.83e-27
Family FAS1 domain 0.0027
Further Details:      
 
Domain Number 4 Region: 1725-1879
Classification Level Classification E-value
Superfamily FAS1 domain 2.22e-25
Family FAS1 domain 0.0044
Further Details:      
 
Domain Number 5 Region: 975-1131
Classification Level Classification E-value
Superfamily FAS1 domain 1.57e-24
Family FAS1 domain 0.0032
Further Details:      
 
Domain Number 6 Region: 377-501
Classification Level Classification E-value
Superfamily FAS1 domain 4.45e-19
Family FAS1 domain 0.004
Further Details:      
 
Domain Number 7 Region: 2310-2473
Classification Level Classification E-value
Superfamily FAS1 domain 9.29e-17
Family FAS1 domain 0.012
Further Details:      
 
Domain Number 8 Region: 1140-1243
Classification Level Classification E-value
Superfamily FAS1 domain 0.000000000876
Family FAS1 domain 0.0068
Further Details:      
 
Domain Number 9 Region: 1555-1592
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000502
Family Merozoite surface protein 1 (MSP-1) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012999338.1.53824
Sequence length 2581
Comment PREDICTED: stabilin-1 isoform X2 [Cavia porcellus]; AA=GCF_000151735.1; RF=representative genome; TAX=10141; STAX=10141; NAME=Cavia porcellus; strain=inbred line 2N; AL=Scaffold; RT=Major
Sequence
MAEPWGRLLLCFLVFWLSGSSFTRGQKVRSKHCDVKTKFITHTPCTSCAVKKWMCPSGWL
LQRFPDRASQNCRYEVQLGDSLMSMNGCSMECWKDVVQKACCPGYWGSQCYECPGGAETP
CNGHGTCLDGMAGNGTCVCQENFRGSACQECQDPRRFGTDCQSECSCVHGVCSSGPQGNG
SCLCFAGYTGPRCNQELPACQNLNCPPNSQCSPEAPACRCLPGYTLKDSRCVAPNPCHPS
PCSSIAHCSVSPEGHAQCRCPENYHGDGKVCLPYDPCTANFGGCPRNSTVCVYQKPGKAT
CSCQPGLVSANHNASAGCFAYCFPHSCDKSATCQVTPEGRTRCQCKAGEVGDGRACYGHL
LHEVQKANEMGTLFQRLKVTVTMLEQGCQEIVTTSGPFTVLVPSTISSISSRNMNVTLAQ
QLCRQHIIAGQHILEDGGLPSTQRWWTLAGQEITVTFSRTRYTYQYKDQPQQTFIILKAN
NIAANGVFHVVTALRWQPPPALPGDLKVLPGLPGDPKHTIAQILSSNEAFSRFETILENC
GLPSILDGPGPFTVFVPSNEAVDSLRDGRLIYLFTEGLSKLQELVRYHIFSRGQMTVDKL
IAKRRILTMANQVLAVNISNEGRILLGPEGIPLRRVDMLAANGVIHMLEGVLLPPTILPI
LPKHCDEEQHEIVMGSCVDCQALNTSVCPPNSVKLDIFPKECVYTHSALGFSVLKKGCAH
NCNQTITKRGCCKGFFGPDCTQCPGGFSSPCYGKGNCSDGIRGSGACLCFPDYKGIACHV
CSNPNKHGDHCQEDCGCVHGLCDNRPGSGGVCQHGTCAPGFSGHFCNETVRDCGPPGLAQ
RCHPHARCISQDGVSRCVCLDDFEGDGYSCTRRHPCSQPDRGGCSENAECVPGDLGNHNC
TCHRGWSGDGRVCVPIDECGLDTRGGCHADALCSYVGPGQSRCTCKLGFAGDGYQCSPID
PCRAGNGGCHDLATCKAVGGGQRVCTCPPHFGGDGFSCYGDIIRELEANAHFSTFYQWFK
SAGITLSADSRVTALVPSDFAIRRLSPENKSFWLQPKMLPYLVRAHFLQGTLSEEDLARL
GGQDVATLNPTMRWEIRNISGRVWVQNASVDVADLLATNGVLHIINQVLLPLRGDVQVGQ
GVLERLGQVPTFRLFRELLQHHSLVPQLEAATAYTIFVPTNQSLEAQGNSSSLDADTVLH
HVILGEALSMEALQKGGHRNSMLGPTHWLVFYNHSGQPEVNHMPLEGPFLKGPGYSLFGL
SGVLTVGRSRCMLSHTEAQREKCVSCSRKFRCTQGYQLQDTPRKSCVYRAGLAISRGCSY
TCVKKIQVPDCCPGYFGTLCEPCPRGLGGVCSGHGQCQDRFLGNGECRCHEGFHGTACEM
CELGRYGPNCTGVCNCAHGLCQEGLRGNGSCVCNVGWQGLRCDQKITGPQCEEKCDPNAN
CMQSSAGAPACVCAAGYSGNGSYCSEVDPCAHGHGGCSPHASCTKVAPGQRTCTCQDGYT
GDGELCQEVNSCLNHNGGCHIHAECIPTGPQQVSCSCHEGYSGDGIRTCELLDPCSKNNG
GCSPYAVCKSTGDGQRTCTCDAARTVGDGFTCRTRVGLELLRDKNASFFSLHLLEYRELK
GDGPFTIFVPQADLMTNMSQEELARIRAHRQMVFRYHVVGCRRLWSPDLLEQEYATALSG
HSLRFSEREGSIYINDFARVVSSDHEAVNGVLHFIDQVLLPPDVVYWEPGAVTVPRNLTI
TTAADSFGYKTFSHLVKMAGLLPMLQDASHRPLTMLWPTDAALQALPPDRQAWLYHEDHR
DRLAAILRGHVIRNMEALASDLPNLGLLRTMHGTPISFSCSRGRPGELMVGEDDARIVQR
YLAFEGGLAYGIDQLLEPPGLGARCDRFETRPLRLKICSVCGQEPPCPEGSREEGSTETC
WRYPKLWTNALLHPFMLGGVWVRPSYWGQPQSLDRGCQRSCVTTIWKPTCCPGHYGSECQ
ACPGGPSSPCNDHGVCLDGMNGSGQCKCHLGFAGMACELCAPGAFGPQCQACRCMPHGRC
DEGLGGSGSCFCDEGWTGPHCEVQLELQPVCTPPCASQAMCRAGNHCECGLGYEGDGRVC
TVADLCQDGHGGCSEHANCSQVGTVVTCACLANYEGDGWSCRPRNPCADSHRGGCSEHAD
CLYTGPNTRRCKCHAGYVGDGLQCLEEAEPPVDRCLGRPSPCHSDAVCTDLHFQEKWAGV
FHLQATSGQYGLNFSEAEAACGAQGAVLASFSQLSAAQQLGLHLCLVGWLANGSAAHPAV
FPAADCGDGQVGVVSLGTRKNLSERWDAYCYRVQDVACRCRDGFVGDGISVCNGKLLDVL
AATANFSTFYGMLLDYANATKRGLDFLGFLDDELTYKTLFVPVNEAFVNNMTLSGPDLEL
HASNTTFLHTNATQGTLLPAHSGLSLVISDVGPDNSSWAPAAPGTVVVRHIIVWDIIAFN
GIIHALASPLMSPPQAGAVIVPESLPVAASVGAVVVIGALLCLVAAALYLRVRGKPAGFG
FSTFQAEDDADDDFAPWQEGHPTLVSVPNPVFGSHDAVCEPFDDSLLEDDFPDTQRILAV
K
Download sequence
Identical sequences XP_012999338.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]