SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013004467.1.53824 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013004467.1.53824
Domain Number 1 Region: 533-590
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 197-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.6e-23
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 589-646
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.48e-22
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 4 Region: 477-534
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.71e-22
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 5 Region: 365-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.74e-21
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 6 Region: 253-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.59e-21
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 7 Region: 421-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.48e-20
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 8 Region: 141-198
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.07e-19
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 9 Region: 309-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.75e-18
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 10 Region: 13-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-16
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 11 Region: 635-687
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000168
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 12 Region: 108-155
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000118
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013004467.1.53824
Sequence length 694
Comment PREDICTED: zinc finger protein 260-like isoform X1 [Cavia porcellus]; AA=GCF_000151735.1; RF=representative genome; TAX=10141; STAX=10141; NAME=Cavia porcellus; strain=inbred line 2N; AL=Scaffold; RT=Major
Sequence
MWPTRRLECPRPSMETVTFEDVTVKFTPEEWDLLTPFQKKLYRGVMWETYMNVTVTRRIW
HNLQIKEEDKNCSRNLRYDGDNYLRIEEQQYKYNEDVETCSDFQSFQKQCEKAFSTLSSC
QRHKNIHTGEKPCVYNKCGKAFTTASKCKALDRTHTGEKHFRCRQCGKSFNRKDNLINHE
RVHTGEKPYVCNKCGKAFSRASGYKTHERIHTGEKPFVCKQCGRSFNRKDNLSNHERVHT
GEKPFVCNKCGKAFISASQCHNHDRVHTVEKPFVCKECGKSFNRKDNLINHERIHTGEKP
YVCNKCGKAFISASQCQKHDRIHTRVKPLVCNQCGKFFKQKRYLIMHEILHTAEKPYVCN
KCGKAFISASQYQIHDRIHTGERPFLCKQCGKSFMQKRHLIIHGRIHTEEKPFLCKQCGK
SFKQKHYLIIHERLHTAEKPYVCNKCGKAFISASKCQIHGRIHTGERPFLCKQCGKSFTQ
KRYLITHDRIHTEEKPFLCKQCGKSFKQKHYLIIHERLHTGEKPYVCNRCGKAFSSASSL
KAHDRIHTGEKPYVCKQCGKSFSHNSTLIIHERIHTGEKPFVCNKCGKSFNQKDNLIKHE
RIHTGEKPYVCNTCGKAFVSAKRCKAHCRIHTGEKPFVCNQCGKSFKQKRSLIMHESLPA
GVKPYVCNKCGKAFRTASSCKKHERTHWGDTICM
Download sequence
Identical sequences XP_013004467.1.53824 XP_013004468.1.53824 XP_013004469.1.53824 XP_013004470.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]