SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013004681.1.53824 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013004681.1.53824
Domain Number 1 Region: 25-101
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000118
Family DEATH effector domain, DED 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013004681.1.53824
Sequence length 318
Comment PREDICTED: death effector domain-containing protein [Cavia porcellus]; AA=GCF_000151735.1; RF=representative genome; TAX=10141; STAX=10141; NAME=Cavia porcellus; strain=inbred line 2N; AL=Scaffold; RT=Major
Sequence
MAGLKRRAGQVWPEEHGEQEHGLYSLHRMFDIVGTHLTHRDVRVLSFLFVDVIDDHERGL
IRNGRDFLLALERQGRCDESNFRQVLQLLRIITRHDLLPYVTLKRRRAVCPDLVDKYLEE
TSIRYVTPRTLSDPEPRPPQPPKTVPPHYPVVCCPTSGPQMCSKRPARGRATLGSQRKRR
KSVTPDPKEKQTCDIRLRVRAEYCQHDTALQGNVFSNKQDPLERQFERFSQANTILKSRD
LGSIICDIKFSELTYLDAFWRDYINGSLLEALKGVFITDSLKQAVGHEAIKLLVNVDEED
YELGRQKLLRNLMLQALP
Download sequence
Identical sequences A0A286XDA3
10141.ENSCPOP00000013807 ENSCPOP00000013807 XP_003466629.1.53824 XP_013004679.1.53824 XP_013004680.1.53824 XP_013004681.1.53824 ENSCPOP00000013807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]