SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013007605.1.53824 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013007605.1.53824
Domain Number 1 Region: 32-178
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 4.46e-23
Family N-acetyl transferase, NAT 0.000000499
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_013007605.1.53824
Sequence length 207
Comment PREDICTED: serotonin N-acetyltransferase [Cavia porcellus]; AA=GCF_000151735.1; RF=representative genome; TAX=10141; STAX=10141; NAME=Cavia porcellus; strain=inbred line 2N; AL=Scaffold; RT=Major
Sequence
MAMQSILPLKREALSLLSGTSESQSCQRRHTLPASEFRCLTLEDAVSVFEIEREAFISVS
GICPLYLDEIRHFLTLCPELSLGWFEEGRLVAFIIGSLWDKKRLTQESLTLHRPGGRMAH
LHVLAVHRTFRQQGKGSILLWRYLQYLGGQPAVRRAVLMCEHVLVPFYEKFGFQAVGPCA
VAVGSLAFTELQCSLRSHAFLRRNSGC
Download sequence
Identical sequences ENSCPOP00000018621 XP_013007605.1.53824 XP_013007609.1.53824 ENSCPOP00000018621 10141.ENSCPOP00000018621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]