SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013010006.1.53824 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013010006.1.53824
Domain Number 1 Region: 33-274
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.62e-66
Family LplA-like 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013010006.1.53824
Sequence length 373
Comment PREDICTED: lipoyltransferase 1, mitochondrial isoform X2 [Cavia porcellus]; AA=GCF_000151735.1; RF=representative genome; TAX=10141; STAX=10141; NAME=Cavia porcellus; strain=inbred line 2N; AL=Scaffold; RT=Major
Sequence
MLIPFLMKNCFQLLCTHKVPAAGFKNAVKSGLILQSVSSDVYQNLAVEDWIHDHVNLEGK
PILFFWRNTPSLVIGRHQNPWQECNLSLMRERGVKLARRLSGGGAVYHDMGNINLTFFTT
RTKYDRMENLKLIVRALNAIQPQLDVQATKRFDLLLDGQFKISGTAAKIGRTTAYHHCTL
LCSTDRTSLSSLLKSPYQGIKSNATQSIPAMVKNLLEKDPTLTCEGLINAIAAEYAAHHQ
IDHHITFINPTDETLFPGINSRAKELQTWEWIYGRTPKFSISTAFNVLGEQTPLEIKVFL
DIKNGRIEICRIEAPYHWLPLEIYEKLNSGLTGSKFCPVETTMITHMLLRTCPEDQELHS
KWNVLCEKIKGIM
Download sequence
Identical sequences XP_003471612.1.53824 XP_013010005.1.53824 XP_013010006.1.53824 10141.ENSCPOP00000011055 ENSCPOP00000011055 ENSCPOP00000011055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]