SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013013225.1.53824 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013013225.1.53824
Domain Number 1 Region: 158-267
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.29e-21
Family Synaptotagmin-like (S variant) 0.035
Further Details:      
 
Domain Number 2 Region: 302-505
Classification Level Classification E-value
Superfamily vWA-like 5.68e-20
Family Integrin A (or I) domain 0.021
Further Details:      
 
Domain Number 3 Region: 19-136
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.21e-16
Family Synaptotagmin-like (S variant) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013013225.1.53824
Sequence length 557
Comment PREDICTED: copine-6 [Cavia porcellus]; AA=GCF_000151735.1; RF=representative genome; TAX=10141; STAX=10141; NAME=Cavia porcellus; strain=inbred line 2N; AL=Scaffold; RT=Major
Sequence
MSDPEMGWVPEPPTMTLGASRVELRVSCHGLLDRDTLAKPHPCVLLKLYSEEQWVEVERT
EVLRSCSSPVFSRALALEYFFEEKQPLQFHVFDAEDGATSPSSDTFLGSTECTLGQIVSQ
TKVTKPLLLKNGKTAGKSTITIVAEEISGTNDYVQLTFRAQKLDNKDLFSKSDPFMEIYK
TNRDQSDQLVWRTEVVKNNLNPSWEPFRLSLHSLCSCDVHRPLKFLVYDYDSSGKHDFIG
EFTSTFQEMQEGTANPGQEMQWDCINPKYRDKKKNYKSSGSVVLAQCTVEKVHTFLDYIM
GGCQISFTVAIDFTASNGDPRSSQSLHCLSPRQPNHYLQALRAVGGICQDYDSDKRFPAF
GFGARIPPNFEVSHDFAINFDPENPECEEISGVITSYRRCLPQIQLYGPTNVAPIINRVA
GPAQREQSTGQATKYSVLLVLTDGVVSDMAETRTAIVRASRLPMSIIIVGVGNADFSDMR
LLDGDDGPLRCPQGVPAARDIVQFVPFRDFKDAAPSALAKCVLAEVPRQVVEYYASQGIS
PGAPRPCTPGTTPSPSP
Download sequence
Identical sequences H0V113
ENSCPOP00000003169 10141.ENSCPOP00000003169 ENSCPOP00000003169 XP_013013223.1.53824 XP_013013224.1.53824 XP_013013225.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]