SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013014705.1.53824 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013014705.1.53824
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily DEATH domain 2.68e-23
Family Caspase recruitment domain, CARD 0.0000104
Further Details:      
 
Domain Number 2 Region: 110-192
Classification Level Classification E-value
Superfamily DEATH domain 2.35e-18
Family DEATH domain, DD 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013014705.1.53824
Sequence length 199
Comment PREDICTED: death domain-containing protein CRADD isoform X2 [Cavia porcellus]; AA=GCF_000151735.1; RF=representative genome; TAX=10141; STAX=10141; NAME=Cavia porcellus; strain=inbred line 2N; AL=Scaffold; RT=Major
Sequence
MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHVQEIKAQTTGLRKTMLLLDI
LPSRGPKAFDTFLDSLQEFPWVREKLEKAREEAITELPKGDQVPGIPSHILNSSPSDQQI
NQLAQRLGAEWEHVVLSLGLSQTDVYRCKANHPHNVQSQVVEAFVRWRQRYGKQATFLSL
HKGLQAVEADPSVLQHVLE
Download sequence
Identical sequences A0A286XWV4
ENSCPOP00000015312 ENSCPOP00000015312 10141.ENSCPOP00000015312 XP_013014705.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]