SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013026026.1.62511 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013026026.1.62511
Domain Number 1 Region: 53-175
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.85e-19
Family Glutathione S-transferase (GST), C-terminal domain 0.0045
Further Details:      
 
Domain Number 2 Region: 12-63
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000011
Family Glutathione S-transferase (GST), N-terminal domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_013026026.1.62511
Sequence length 180
Comment glutathione S-transferase Gst2 [Schizosaccharomyces cryophilus OY26]; AA=GCF_000004155.1; RF=representative genome; TAX=653667; STAX=866546; NAME=Schizosaccharomyces cryophilus OY26; strain=OY26; AL=Scaffold; RT=Major
Sequence
MTQLTLFSCRGILYDVGKNEQKSEEHLDYNPNGRVPTLIDHQNNGYAIWESAAILAYLTD
KQGAIWGQAGWLNFFHPEPVASAVTRYRNETKRVLGVLERILQNKDYLVTDKYTIADMSF
INWNDLLPPLFGKGRHEFKEDLPQLDFEKEFSKTYAWHQSLTERPAVAAILKEWEQSRQQ
Download sequence
Identical sequences S9X5T6
XP_013026026.1.62511 EPY49156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]