SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013031292.1.65836 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013031292.1.65836
Domain Number 1 Region: 235-331
Classification Level Classification E-value
Superfamily Immunoglobulin 4.45e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 2 Region: 395-681
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 3.4e-18
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.042
Further Details:      
 
Domain Number 3 Region: 157-248
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000474
Family I set domains 0.025
Further Details:      
 
Domain Number 4 Region: 2-36
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000152
Family Ovomucoid domain III-like 0.012
Further Details:      
 
Domain Number 5 Region: 79-150
Classification Level Classification E-value
Superfamily EF-hand 0.000000000245
Family Calmodulin-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_013031292.1.65836
Sequence length 743
Comment PREDICTED: follistatin-related protein 4 isoform X4 [Anser cygnoides domesticus]; AA=GCF_000971095.1; RF=representative genome; TAX=381198; STAX=8845; NAME=Anser cygnoides domesticus; breed=Zhedong; AL=Scaffold; RT=Major
Sequence
MPVCGSDGKFYENHCQLHRASCLQRKKIYIIHSKDCFFKGDTCTMANYSRLKSILLDLQA
RRRSPPSSLAADRAAQKRFLVEDLFKHLDVNGDRHLSSSELAQLMEEEDLDDDLLDCTLE
DLLRFDDYNNDGRLTLQELYTAFQVVRLSLPEDQKVSVTTITVGLSTILTCGIRGVLRPP
IIWKRNGIILNFLDLEDINDFGEDDSLYITKVTTIHMGNYTCHAYGYEELYQTHILQVNV
PPVIRVYPETQAQEPGVSASLKCHAEGIPNPRITWLKNGVDIMPKLSKQLTLLANGSELH
ISSVRYEDTGAYTCIAKNEVGVDEDISSLFIEDSARKTLANILWREEGLSVGNMFYVFSD
DGITVLQPNECEIRRHIRPEERIFTSYEEICPRVEGEGTQSCLWASAVNVRDKYIYVTQP
KQHRVMIIDIQTQKAIQSLDVDPLPTKLHYDKSHDQVWVLSWGDMRKSSPTLQVIPEASA
GEYQHVIRTPFEGVDDFFIPPTNLIINHVRFGFIFNKSKSAVHKIDLETVTHVKTISFRN
YSCVPQTMAYTHLGGYFLVQCRRNRPRAASPQLLIDSVTDAVIGTNSDVSGTPHVSPDGR
YLVSADEDSGRIKVQAVTVQGEIKLIYDLQTNIHVSDLTFQPSFTEGNQYYIYATSHLQT
DVLFVELSTGKMNVLKNLKDPITSKDWPWSSHNRIMKDSGLFGQYLITPAKDSLFVINGK
QNTLRCEVSGIRRGNTVVWVGEV
Download sequence
Identical sequences XP_013031292.1.65836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]