SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013047863.1.65836 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013047863.1.65836
Domain Number 1 Region: 5-123
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 1.31e-51
Family TRADD, N-terminal domain 0.0000256
Further Details:      
 
Domain Number 2 Region: 166-259
Classification Level Classification E-value
Superfamily DEATH domain 2.12e-16
Family DEATH domain, DD 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_013047863.1.65836
Sequence length 265
Comment PREDICTED: tumor necrosis factor receptor type 1-associated DEATH domain protein isoform X2 [Anser cygnoides domesticus]; AA=GCF_000971095.1; RF=representative genome; TAX=381198; STAX=8845; NAME=Anser cygnoides domesticus; breed=Zhedong; AL=Scaffold; RT=Major
Sequence
MPFFNLTHTDSTGSVNGVDMLKVHCSHPHLIVQLKFCKQENCRRFLQSYREGVLQESLQN
HLQLSLAMTTVPLEMELKAGNEHLDNMLKDEDRCLECIYREKPDRLRDEEITELEEYLKS
LILHQNINNNLPAKDCASLNSPSLPSQGSSPSPQVTFLFQGQQFANRTLTPDDHQKFAKL
VSKKWKQVGRSLQRSCRALRDPVIDNLALEYDREGLYEQAYQLLLRFIQSEGKKATIARL
IAALEENGLTSLAEELLGLHSHEDS
Download sequence
Identical sequences XP_013047863.1.65836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]