SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013050837.1.65836 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013050837.1.65836
Domain Number 1 Region: 47-510
Classification Level Classification E-value
Superfamily Sema domain 1.16e-121
Family Sema domain 0.0000568
Further Details:      
 
Domain Number 2 Region: 1690-1817,2006-2192
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.18e-45
Family p120GAP domain-like 0.013
Further Details:      
 
Domain Number 3 Region: 1157-1251
Classification Level Classification E-value
Superfamily E set domains 1.15e-16
Family Other IPT/TIG domains 0.0085
Further Details:      
 
Domain Number 4 Region: 513-565
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000275
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 5 Region: 1249-1339
Classification Level Classification E-value
Superfamily E set domains 0.000000000000522
Family Other IPT/TIG domains 0.056
Further Details:      
 
Domain Number 6 Region: 1339-1383,1412-1464
Classification Level Classification E-value
Superfamily E set domains 0.0000000952
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013050837.1.65836
Sequence length 2225
Comment PREDICTED: plexin-B1 isoform X1 [Anser cygnoides domesticus]; AA=GCF_000971095.1; RF=representative genome; TAX=381198; STAX=8845; NAME=Anser cygnoides domesticus; breed=Zhedong; AL=Scaffold; RT=Major
Sequence
MGKRVQVRCREKRMLIWVRAFTMHLGTFFLPVLCFLGAAIPRGLQYVTFSRNATKFLHLS
MDLESGTIYLGATNFLFQLTSDLLMKNVVQTGPVLDSKDCLPPVSRLECPQAHHTDNHNK
LLLVNAVQKELIVCGSVHQGICEKRSLASIDHVLFRPESPGDTQYVAANDPNITTVGLVA
YSKDEVPLLFVGRGYTSRGVGGGIPPITTRNLRAHGGDIQATDSHSIFSYEETAKLAVGR
LSEYNHHFIKSFTYRSSVYFLFYRRDLKSQSREYKTYISRICLDDSHYYSYVELPLLCQS
QANTYSLLQAAYVTRPGTDLAQGQLDTDGEVLFAAFSAWQASSGKLSEESALCIYAMEEV
DRLTNWTRDVCYMRDGKSEEGTEVAYIEYDVSSNCVQLPADTLYAYPCGSDHTPSPMASR
VPLEAAPLLEKTDARLTAVAVNVEDGHTIVFLGDSRGRLHKVYLGAMGDAHIYASLPIQL
NSVVSGDLLFDQLQENLFVMTQSMVVKVPILECSLYLDCESCLAVKDPYCGWCVLQGRCS
RRSECLRSRLSEQWLWSFNSTQQCLSVQSLTPANISREEKRNIFLAISDLPSLHEEEFYS
CYFEDYESPAVLTESGIMCPSPDPSQAPTLPAGADHVTIKLVVRFHDIFIASVDFSFYDC
AAVALLWKSAPCQKCVSSPWGCNWCIQQHLCTHKAACEEGIIIYNERAQLPTSSVFPSSA
APLTKSSTIAPVVATKPITPPVRVVLSTASPTEPNHVTPSAASDSMTEPTETFSYTTSTL
STEAASLQAVTEAPLPPPADKPAVTLPDTTSPAASVLTSPSKNGDHAALPTVGPATAQEP
WHTDPPTTAVATPLLTTAPAVTPSPHITSFRWPPNSFPTTEALTSAIPSPQPPSEVPGET
AVSDDSPGLLGTEIPASELPPSAPPDWLLGEDTELQDTEDWMDLLQAENDTSPFSASTLL
SGDGDSSERDVPDLPRILHPDLDYQYDAPGFWEENEEFSWGPGACPCVQGIQGSSLFPVN
VARKITLLGKNFHLYQDQQWDYECVLNLEGRTMVMDAYVEGEETNQSLCYITCQLNQYSY
AAPQLEFNAVVFVQRRRHLRVDSAADLHVTFYNCSVGHTDCSRCQTADSKYNCVWCGGSN
PSCIFRGSCKEEIEDLCPAPLIHSVYPLSGPVEGGTRITITGSNLGQKHQDIAETVTVAG
IPCAVDAQEYEISSSIVCVTGGSWTERFGHVVVEVPGGGRGVSGHIFTYQNPELKSIVPT
QGPKAGGTCLTLLGSKLLTGHPSEISVLLGDLPCRILSEMTEDQLACQTSPSNVSAELPV
TIKYGDQERRLEGSLFRYTLDPNITFAEPPKSFLSGGRVLRVHGYNLDVVQRPKIRVTVS
PSERRRRGVGRWRRIIPDTECPEGALCSIQQFEEPCLVNSSYLILCKTPAINLLLRSVHI
KLEFILDNLSFDFNSLHPMPFSYEVNPILKPLNAEDPAKPYRHKPGSVISVEGENLDLAI
SKDEVMAMIGEGICVVKTLTRNHLYCEPPSEQPAPRHRTKREGTDLLPEFTVQMGNLNFL
LGRVQYDTESQLTFPLEAQIGLGVGASFVALVVLVIVFIYRRKSKQALRDYKKVQIQLEN
LETSVRDRCKKEFTDLMTEMMDLTSDLVGTGIPFLDYKSYAERIFFPGHRESPLQRDLDI
PECRRQTVEQGLVQLSNLLNSKLFLTKFIHTLEIQRTFSPRDRAYVASLLTVSLHGKLEY
FTDILKTLLNDLVEQYVAKNPKLMLRRTETVVEKLLTNWMSICLYAFVRDSVGEPLYMLF
RGIKHQVDKGPVDWVTGKAKYTLNDNRLLREDLEYRTLTLNALTQAGVAAGGAEDSQGIS
AKVLDCDTITQVKEKILDQIYKGTPYCHRPDPDTLDLEWRSGLAGHLILSDEDVTSVVQG
TWKRLNTLQHYKVPDGATVALVPRLTKHIHRENQDYIPGEKTPMLEDADEGGIKLWHLVK
PTEEPELPKHRRGSLRDRERAKAIPEIYLTRLLSMKGTLQKFVDDLFQVILSTNRPVPLA
VKYFFDLLDEQALHYGIADPETIHIWKTNSLPLRFWINIIKNPQFVFDVQTSDNVDAVLL
VIAQTFMDSCTIADHKLGRDSPINKLLYARDIPRYKQMVERYYADIRQTISASDQEMNSA
LAELSRNYSGDLNSLVALHELYKYINKYYDQIITALEEDPTAQKMQLGYRLQQIAAAVEN
KVTDL
Download sequence
Identical sequences XP_013050837.1.65836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]