SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013077467.1.17457 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013077467.1.17457
Domain Number 1 Region: 78-286
Classification Level Classification E-value
Superfamily L domain-like 1.28e-27
Family Ngr ectodomain-like 0.041
Further Details:      
 
Domain Number 2 Region: 569-786
Classification Level Classification E-value
Superfamily L domain-like 1.96e-26
Family Ngr ectodomain-like 0.014
Further Details:      
 
Domain Number 3 Region: 841-945
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.31e-17
Family Toll/Interleukin receptor TIR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_013077467.1.17457
Sequence length 982
Comment PREDICTED: toll-like receptor 5 isoform X1 [Biomphalaria glabrata]; AA=GCF_000457365.1; RF=representative genome; TAX=6526; STAX=6526; NAME=Biomphalaria glabrata; AL=Scaffold; RT=Major
Sequence
MPSIMITVAVFLCLLSSVWLASLVHTVHQLGVNTDKFSEHVLRQNASLKHFILSSNGYGI
QQSQSNKQAGASLSQSPCSVLNKVVDCSSLSLETIHPSWFPSDAHVILLNNNHLTSLVDS
SFAHVSNLTDLDLSSNEISHLEPRAFRGLTNLTTLNLNDNRLCLNTKHISEQTFSDLPNL
KVLNIIQDTDLRDCNVSHTYLEPLRNLQRLSIGANEEVLYFGSEFRSLTNLEALEVTGSA
QVIHDKTFENLGAIKELYLKNMNNLFNISSSVFVPLTHLLSLKMENVLVDVQYALSLLEP
FVGKNMTEIYFNIVSTTREKATPNKNGLLTRKDTKYLLQICVRSFTLINSYISYISMNAF
GYSSVWSDSLYSLFVSDNPLQGSSSAMFPLTKYTHLETITVEKALRSCDRFHDFQYSNKE
AALDTLRKRREVTGLDTLRKRREVAGLDTLRKRREVAGLDTLRKRREVAGLDTLRKRREV
AGLDTLRKRREVAGLDTLRKRREVAGLDTLRKLREVTGLEDKFKMNAVGNDKFTSEAGAP
NFIIFKLPVSLRSLQMSRLVSSVALDVNLLFLGAANVDYLDVSDNGFKTFVGNIQGLHSL
KTAVVSLNDMRELKESFFDGFFGLEKLFLSKCELQRDFMALHSSRVFQNLSNLQSLDLSY
NYLNDLSQGTLYYNPKLVWLNLSDNQFNRIPFDLKDTPNLLELDVRNNAISTVSKSITTE
LDQLALRNGKLNFWLSGNILSCGCQDLNFLHWLSSTMVTLDQGGNFTCMDRNGERSYTMR
YSHVDTLWRECWGQYFLYLAIIILCFYVTGVFLLVLVQRNKTFLVSFFLQLLGNFKLLKR
GDYPIDVFVGYSDEDYHFPCRDLRLYLEDVIKLKTFLNDRDLLASLSKASGIVDAINSSY
RILLVCSESFLKDDDWSLFTMRAAMYAQSPANPSRVVVVVHESCLHLLPTELLSVVNEEN
ILVVSGWKLNYEITEMLRTRLQ
Download sequence
Identical sequences A0A2C9LD16
XP_013077467.1.17457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]