SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013078565.1.17457 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013078565.1.17457
Domain Number 1 Region: 92-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000256
Family EGF-type module 0.006
Further Details:      
 
Domain Number 2 Region: 6-50
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000759
Family EGF-type module 0.018
Further Details:      
 
Domain Number 3 Region: 134-161
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000411
Family EGF-type module 0.01
Further Details:      
 
Domain Number 4 Region: 60-100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000264
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_013078565.1.17457
Sequence length 161
Comment PREDICTED: fibropellin-3-like, partial [Biomphalaria glabrata]; AA=GCF_000457365.1; RF=representative genome; TAX=6526; STAX=6526; NAME=Biomphalaria glabrata; AL=Scaffold; RT=Major
Sequence
SVCSSSHDPCQSHPCHNHGTCHTNGSEFTCDCPLGYTGPTCAELVPSYQSVSWDHGNNDT
QDCKLQCDNGGTCVPIGPVSQCHCLDGFTGLHCEVNMDDCLENYCLNGGQCLDGVNIFTC
LCPKGFSGDLCQINLDDCVSSPCQNNGVCIDNIDGFTCVCQ
Download sequence
Identical sequences A0A2C9LVL3
XP_013078565.1.17457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]