SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013086792.1.17457 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013086792.1.17457
Domain Number 1 Region: 452-698
Classification Level Classification E-value
Superfamily L domain-like 2.99e-27
Family Ngr ectodomain-like 0.024
Further Details:      
 
Domain Number 2 Region: 56-269
Classification Level Classification E-value
Superfamily L domain-like 1.15e-23
Family Ngr ectodomain-like 0.016
Further Details:      
 
Domain Number 3 Region: 774-855
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.0000275
Family Toll/Interleukin receptor TIR domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_013086792.1.17457
Sequence length 896
Comment PREDICTED: toll-like receptor 13 [Biomphalaria glabrata]; AA=GCF_000457365.1; RF=representative genome; TAX=6526; STAX=6526; NAME=Biomphalaria glabrata; AL=Scaffold; RT=Major
Sequence
MKLVFSSNFPFVILGLCIRIHVLGGANTGTASLQETSKYQDKIPCTLTFRRLEVKADCQR
QSLDYVSNVWFPKNITILLLNENLLTTLENTTFVGLSKLRILDISRNLISKIDIFAFVDL
VSLEYLNLEWNRLNIYSHPEIDLCPLVNLTELRIKQQWLEGKIQSQRHASSNASKPTGYP
KLLGCLTNLRILNLDTRGDTLYFDYFFSNLTKLTYLGIQGGVNQVTNSSFENVKTVKSLY
WSACDVAKFDDMAFGAFEHLETLFLDHVAVGFHRALQLLKPLVNTNMTSIVLYEVIINYY
DKSLGITTGDGLLTKNDTIYLTSICVKQVIIYRNNIFVIETGALSSEVWDRCLKFLDLSE
TSLLSKREILRDVFMMRSIEFVILTGDWLEKHYYSSFVDNIASDKEYGSLLLSHLKDKQG
YLIKSQYNKKHPQKFNVKERADVLYNWIVKNIFLDDSSIITLRISESIKYIDLNWYFNSV
NFKRNIHFMNASKVQYIDFSFNNGYNFIGNISGFTGVRTLILSGNNLNVLSTIFFDGFSS
LELLELSQCNFDSTFITMHSQRLFQSLVNLTSLDLSNNLLSFLPRKIFLTNTKLRWLNLE
GNRFISVPFDLRITPEMEWLSLRTNSIVSLDKGTMMALDAQTRILGKLYLFLDGNVLSCA
CPSLVFLKWLMNTSVTLDKNGNFTCLDRNYLVSYVFKFKDIGDFWRQCVGEDFFYAALVI
YGVFTIVLLVALIYARKWRVVMSGVYHLLYGFKLHTSRDYSMIFIICPDPNISHLLKRSL
SRCIRGLPVHIHGADDVAGENVLMSICNNVASSWRIICVVSDQFFQVEFLSFAISTALIA
HSPANPGQLIYLVQESLYDQVPQEWLAAVEEENIMVVPSWNLSYNLIQTLKMRIRG
Download sequence
Identical sequences A0A2C9L976
XP_013086792.1.17457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]