SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013088300.1.17457 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013088300.1.17457
Domain Number 1 Region: 76-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000335
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 2 Region: 35-75
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000152
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 3 Region: 114-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000485
Family EGF-type module 0.014
Further Details:      
 
Domain Number 4 Region: 151-185
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000445
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_013088300.1.17457
Sequence length 185
Comment PREDICTED: fibropellin-3-like, partial [Biomphalaria glabrata]; AA=GCF_000457365.1; RF=representative genome; TAX=6526; STAX=6526; NAME=Biomphalaria glabrata; AL=Scaffold; RT=Major
Sequence
MDIKRYNFLWIVVCMLHQCQAGESETSARQLQQLKAVGACTSAPCLNAGSCSVHAQSSSY
TCQCLPGFTGQNCELGIDECASSPCLNGACVDNIGSFRCMCFPGYKGRLCEIEIDLCASS
PCHNDGRCVQTGPGNIKCECRPGYRGSRCETDIDECLSLSPCQHGGSCTQGPPGTYICAC
REGYI
Download sequence
Identical sequences A0A2C9KBP6
XP_013088300.1.17457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]