SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013088864.1.17457 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013088864.1.17457
Domain Number 1 Region: 1116-1173
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 1080-1130
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000396
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 1158-1210
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000114
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 4 Region: 1025-1074
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000234
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Domain Number 5 Region: 782-830
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000615
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 6 Region: 503-553
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000846
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 7 Region: 994-1033
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000677
Family Classic zinc finger, C2H2 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_013088864.1.17457
Sequence length 1406
Comment PREDICTED: zinc finger protein 208-like [Biomphalaria glabrata]; AA=GCF_000457365.1; RF=representative genome; TAX=6526; STAX=6526; NAME=Biomphalaria glabrata; AL=Scaffold; RT=Major
Sequence
MTTNGETSKANGTDHEENLHSDFFNSGSEKELQNITTQFDVSDTFITIETKDGLSSKKIP
FSQFLKQVVIDKESGDLKVDFSQLIVSSNGAHKNIAEIISCEENASNKNITTSSPVISLS
NGDASTLSISQTHSGINSTLERPVKKRGRPPKKKPEDNATLQMDTISSSTALKSCTVPVA
GARQNILSMPRRSNRTPAKSSRFGDDYVNSLTLGKVSSSTLSNSTSTWNTQLMTLALAAE
RHKHKPNKPNSEHSGSDTDSVKDSDFGASDLTLEKKSPDKMGSIMDTDASDSAIYIKQVP
LKNNNLSHSKAELSSNGDRVTKAEEKMKKHNIRGPKTLKKYEPVDPVVKRTLQEALLHVT
QATRGHMSFSKPEMENSDCTNPTVYYTIMEPKMAPLGNGLLVQKSEDKINFRIIEFEGEI
SENSELSMTYPQDRYYSCDICCKIFPSLNSWLYHNQYSHNRTMKAFESFPASIGDRQEHV
CDYCHQSFPYSFMLDIHIKRKRHSEIKSFRCTLCRKGFASHKDREEHWLVHHPARSCGLC
GKEFTNIVMLRRHINNNCHGARFRKVPENEGLTADDNMVLSKYKSKMLVDTENEVEEERI
DYATMISENDDEDDFEEEDRVSGHENEKVRCGTCELEFSTSSRLWHHKIEDHREFYPEGF
RDTLQDKLTRYENMLLTASSTEIQKPADGNKNKFFTILKPAWPTEKPKLTISVEDKEFVF
KQNSPRQNILEEMTHNSYSDKKNTSFECLDCSETFLLASSYREHRSKMHGEYFEILKIMG
AFQCTLCSETFPCQFMLDKHVKKHVGKKVLPCTLCGVFFHKIQDRRLHWKTVHPGIGCPN
CGKMYASIKYLQKHISLNCQDHYPPTKKFLEFQKKQHSDFEMSKNEKKVDKKIIRCHLCP
KICSSIHGWRRHMSESHEDAGFSKLSNMCIICNELVYGYKALEKHLLQNHAEDSGLPVEE
EDGLVEEALKKCDIDITAYRKAGRNTSEIYQDEEGNYHCPNCTKVHSDLKALRTHIRIHV
NMKLECSLCHKVFKNPTLLKQHVQRHRKDAVYSCDTCDKKFLTVQKLNKHRKVHHSTGNF
VCDLCGMAFALNDYLQKHKRCHTDKRPHSCTVCGKTFRTKPELRVHVLIHTRETPYKCQY
CSRGFSQKGNYRIHLAQHTGEKPYQCDQCDISFALLCHLKRHKSTHDQKINYRCIWCDKE
CTQRKHMQMHVQRVHKEDFYQHEEQMKLEMPVPIAPAQAKLYNRRIGKANKVRRQYRTKA
QKCDSTIQQLMTGAVQKTEIIDEEMEGSQDIVIEPLVEHMIKTSHESGGYEILVSDDHQN
YAKHSISADLIGQDNVEIVMGENNEISIIIKDPSTLQEVIGDNLETGPVQIHEALQQAVE
AFVIQSKNMQEEVQIPISIEELDKSS
Download sequence
Identical sequences A0A2C9JYF8
XP_013088864.1.17457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]