SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013101163.1.53170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013101163.1.53170
Domain Number 1 Region: 937-1154
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.75e-55
Family DBL homology domain (DH-domain) 0.00027
Further Details:      
 
Domain Number 2 Region: 71-190
Classification Level Classification E-value
Superfamily BRCT domain 1.57e-19
Family DNA-repair protein XRCC1 0.043
Further Details:      
 
Domain Number 3 Region: 208-258
Classification Level Classification E-value
Superfamily BRCT domain 0.000000218
Family DNA-repair protein XRCC1 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_013101163.1.53170
Sequence length 1417
Comment PREDICTED: protein ECT2 isoform X1 [Stomoxys calcitrans]; AA=GCF_001015335.1; RF=representative genome; TAX=35570; STAX=35570; NAME=Stomoxys calcitrans; breed=8C7A2A5H3J4; AL=Scaffold; RT=Major
Sequence
METIDEQSSKYEMSISSSPSPENLRICLVGSVVQNDAAVEAAHTFGVPVITSETGLELVN
DYDWRTYFILNDFEGPVYEAIHKSKQCILGPPALQQAAEMKDGLTHNARPIYNYSMRGVV
TCFTGIRKKDELTKLVNLIHSMGGCIRKDMNSKITHLISSHSGGEKYQYAKTFRLTVVRP
NWVYAAWERRNETDFKATTDEFSKDHKLKAFEGQKICFFGFPADEHQHMVDILKSNGGVP
AELDDPECSHVVMPNTGGYFSETLNNNNNNNCNTNSNSQIQTNPNPEESNPKPDDDNGME
VDDEVESAIEAAKGIEAIKPNLNENLITEGKQLQNIENEEDNDDDEDNDDDEEGHFDVRL
VVDYERNLKQDEDDLVNDLIPFVDDLEEERVVLKPADGNSHASTPKSSKAIHALLPSKQL
EYKINNLVNVTSNEFQNNSANLSPICKKDHQDLTGPAKSTPQDDSCFPMDLDMDDLEADP
DADLDEAQRELKRKRESLDSISLMSVESFALPTSTKKPKLLRTGSISRTIKRSMSFVAVR
TPIAKMLRPRRSSVALDTAPTDITDNDNDDDHNENANDSFCSIASVESTFNESIRKPVKE
KLRSLRNRITRSSSRREKYVVSNNGQKTADNKGEDSAADAQNDKEDFKTPKAPSKYNYAC
LSAPRPNTRSLSQSMSASAVSSTSKISHKSLNLSSIDGPFVNSNNSFFQKMNTSTNLPAD
CKNVGLLGTNALRLTSASASCSITNPIIPPSNQSLEINSNDHHIAHHHHEHHRVVQKQSQ
SYANHNKAANVDSSCAPPTVAPAAIHSVVDKHTTQTKPEPKNHRTHILKSDWFWYTIQNG
YADEMDYLFGDYLDSIANTPNTDRRDSLPISFNKRKRKRFSQRIQLEGTPLGSTKRRSSV
SDAGLLSASGSFFDCTTSPSKLENGTILTEPETSTCEVQTPGKKASMRFNHFMDFYSTES
NYVGILDTIVNLFKNPLEEIAESSDALLNKSEIKAIFGNFIPIHEVHQSMLERLRAIHSK
WSEECLIGDIILQHQDELIKAYPPYVNFFEQMKETLIQCDTQNPRFHAFLKINQTKPECG
RQTLQDLMIRPVQRLPSISLLLNDILKHTNKNNPDYARLEEALKAIRVVMTHINEDKRKT
ESRMAIFDIFNDIEGCPAHLVSSNRNFISRCEVSELTDNLSGRGDSLVLYLFSDSIEVCK
KRSRGFNSAKSPSTAKCYKHIKLMSLNAIRFVIDITDSPRAFALLCRQDKDKLHSFTITD
EEIDKVVYLKSLCKQMAENACRTDTDKALLCRTSQELEVDISDVNLSTLSKAFKLAARTR
LKVGRAFSFNKTPSKLKRAVSTMMTSPFGSTNSLTPASQLAQMRLASCTNIHEVVDDDNS
NMRSSSPSTHSEVIAPPMSVQPTRKNMASCIGSVGRI
Download sequence
Identical sequences A0A1I8Q920
XP_013101163.1.53170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]