SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013102512.1.53170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013102512.1.53170
Domain Number 1 Region: 139-591
Classification Level Classification E-value
Superfamily Sema domain 1.05e-129
Family Sema domain 0.0000623
Further Details:      
 
Domain Number 2 Region: 1476-1605,1814-1968
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.54e-42
Family p120GAP domain-like 0.047
Further Details:      
 
Domain Number 3 Region: 953-1048
Classification Level Classification E-value
Superfamily E set domains 0.00000000000017
Family Other IPT/TIG domains 0.0062
Further Details:      
 
Domain Number 4 Region: 1047-1135
Classification Level Classification E-value
Superfamily E set domains 0.0000000000007
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.08
Further Details:      
 
Domain Number 5 Region: 594-645
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000301
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 6 Region: 1155-1209
Classification Level Classification E-value
Superfamily E set domains 0.0000000926
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_013102512.1.53170
Sequence length 2032
Comment PREDICTED: plexin-A4 [Stomoxys calcitrans]; AA=GCF_001015335.1; RF=representative genome; TAX=35570; STAX=35570; NAME=Stomoxys calcitrans; breed=8C7A2A5H3J4; AL=Scaffold; RT=Major
Sequence
MKFAYLSCRVIVILAFVVQHVTSIEIYNIISLTSSTVEKSDSQAQSPVVPPASVGTSSSA
DLFASAVLSSAYKGFESAALTYEDPNNTSSPPSFNQSLPFSLETKPSSNGGDSSTGPSSA
ASSPAAGSSKNMSNFITKKVQFDTQLNHLVVDTVTGRVYVGGVNNLYQLSPDLDVHESVK
TGPKNDSVECSILDCPVHAIRKPTDNYNKVLLIDRATSRLIVCGSLFQGNCTVHNLQNVS
IIEQEVPDAVVANDANSSTVAFIAPGPPQHPLTNVMYVGVTYTNNSPYRSEIPAVASRSL
EKTKMFQIASSAVTTGTRTFINSYAREGYLVTYVYGFSSERFSYFLTTQLKHNHHSNPKE
YITKLVRICQEDSNYYSYTEIPVDCISTDQGGTKYNLVQAAYLDKPSSDLAESLSVTPQD
DVLFAVFSEGRGNQSTDNSALCIYSLKAIRRKFMQNIKSCFNGVGSRGLDFISPNMPCVP
TKLQTIGEDFCGLDVNSPLGGDQPITAVPVATFKDNLTSIAATSASGYTVVFIGTGNGYL
KKIVVESSTIANEYAEIPINVRSPIQRDMHFDNQNMHLYVMSRSQVAKVKVYDCSGYKTC
GECLGAHDPYCGWCSLENKCSPRSTCQDDVNDPLYWINYKTGKCTTITSVMPHQLQRTTA
RTLELIIDHLPQLKENLVCAFTTEEKALFTNATKKRNGVNCTTPRTDMLPQIGQGKHHFT
AKLSVRTRNGPDLVSTDFTFFDCSTHSSCTRCVSSEFPCDWCVEAHRCTHDTAENCRNDI
LVTGVSRIGPSYRSGPGFCPTINATGDGSEILVAAGTSKSIKVKVHIIGQFIVQTRFVCQ
FNIEGRVTSLNAQLLGDTIYCDSMEFQYTSRSPNLTATFAVIWGGSKPLDNPHDIHVVIY
RCRDMADSCGMCLALAQKYNCGWCSSTNTCEVEEQCNKNNNEGKTDWLNRMETCPNPEIH
YFSPKTGPWEGGTNITIRGINLGKKFTDIYSGVRIAGINCSPFEEYYVDTKEIVCIVDSP
GEQMYRSGRIVVQIGDYRGESKEDYEFVDPKITTFSPRHGPISGGTQIRIIGKYLNSGSR
IQAFINDRLPCEILSVDENQAICSTSSSPGVIEGRLKMVFDNGPREFNEYNFKYVLDPTI
KEVYSGPSGGQIKVPKGIPAGGTEITVLGEYFDNIQAPSMYVIYNNKTFLSQCKVKLPNK
MICDAPTVETNPADMLEAENPQKLEYGFLMDHVLHVQNLSAKLNNYYELYPNPVYYNFEE
RVKYYKSEYLTINGRHLDRACSENDVKVFIGKKLCNITSLSRQQLTCRPPSEPFSGDNYD
SDDDSMVEGKDGSGPEVVVRIGRSLEYRIGVLSYASPNIMDDLGKNAFVVVVSGVILLLL
IFVALLIAYKKKTSESNRVLRNMQEQMDILELRVAAECKEAFAELQTEMTDLTGDLTSGG
IPFLDYCTYAMKILFPNHEDHIVLQWERPELLRKENGLRLFGKLIMNKTFLLLFIRTLES
NRYFSMRERVNVASLIMVTLQSKLEYCTDILKTLLGDLIEKCIEGKSHPKLLLRRTESVA
EKMLSAWFTFLLYKFLKECAGEPLYMLFRAVKGQVDKGPVDACTYEARYSLSEEKLIRQL
IDFRPMTVYASIIQQQIFCNNVEMLPSHTENVPVKVLDCDTIGQVKEKCLDTIYRNIPAS
QKPRKDDLDLEWRTGATGRVILYDEDTTSKTENEWKKLNTLQHYNVPDGAGLSLVPKQSS
IYNFSILSDKNEKSHKYETLNLSKYTSSSPTFSRAGSPLNNDIHENGVKYWHLVKHHDND
VQKEGERVNKLVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLD
DQALLHGITDPEVVHTWKSNSLPLRFWVNLIKNPNFVFDIHKSNIVDSCLSVVAQTFMDS
CSTSDHRLGKDSPSSKLLYAKDIPEYRKWVDRYYHDIREMPPISDQDMNAMLAEESRLHT
SEFNTNCALHELYTYVVKYNEQLAVTLEEDEFSQKQRLAYKLEQVHNIMSAE
Download sequence
Identical sequences A0A1I8PUY5
XP_013102512.1.53170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]