SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013109366.1.53170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013109366.1.53170
Domain Number 1 Region: 50-182,227-243
Classification Level Classification E-value
Superfamily L domain-like 1.93e-39
Family L domain 0.0000849
Further Details:      
 
Domain Number 2 Region: 334-482
Classification Level Classification E-value
Superfamily L domain-like 1.33e-31
Family L domain 0.00032
Further Details:      
 
Domain Number 3 Region: 723-867
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000164
Family Fibronectin type III 0.0081
Further Details:      
 
Domain Number 4 Region: 480-594
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000394
Family Fibronectin type III 0.0084
Further Details:      
 
Domain Number 5 Region: 216-328
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000244
Family Growth factor receptor domain 0.00057
Further Details:      
 
Domain Number 6 Region: 592-657,716-754
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000708
Family Fibronectin type III 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_013109366.1.53170
Sequence length 964
Comment PREDICTED: insulin-like peptide receptor [Stomoxys calcitrans]; AA=GCF_001015335.1; RF=representative genome; TAX=35570; STAX=35570; NAME=Stomoxys calcitrans; breed=8C7A2A5H3J4; AL=Scaffold; RT=Major
Sequence
MLPLNKTLLIFFLATCCLLALLPATSTSATSVGISNKNEVLTRFAPPPYECSSMDIRNHC
SNFEHLNNCTVITGYLIIVLLPSNETCDYSKYRFPKLREITDFLLIYDVKNLTTLEYMFP
NLTVIRGSQLFLNYALGVTQMNELATLEFPSLVAIQRGKVLIGSNPKLCYLEQINFDRLT
VMPGENHIYPAKNVDCSRVPQPVGCASESYWSNMVCQKFENDNIIHYKKGIAHCHDQCLG
GCYNTTAQGCAVCRSWTDHGQCVSKCPKDKYPSQHYLRCYTREECIAKKLVIYKQTCVAK
CPSGYRLNNITQECDSCGGVNSCITVCNSTSALEPIYINTLADMERIKGCHICNGSVFIN
LRNPIKEQELEDSLSEIREIVGHLKVYKNSYLTSLSFFRNLQKIHGTPLENQHYSLVLYN
NQNLTELWPLKDGALELVHGGIYIHANDRLCNSVIQKFRNAIRHDNSLDSLQTSDQEVLC
SPAKLNLDIEVLSHRSIRFAWAKYQTSEEVEIIYRPVEPGKTFSIHSELETSVCERGHWQ
RQLTFPNELQRNDTHYFYTVDKLEPHTRYACLVKTFGDNVEHQARSELKYATTNSDVPQA
PLLEISNKTNASISVRLYYKNREDELVDYYVLDVFEIYENETITDQRDYCEDPMKPYPDY
HNEDFDDCCNRRLEEAEDDVFRQQLQKEFGCSLDHKENCVEENPKARCSSNNTKSWHTKC
LEHYESNYTITGMKQFHLYTVHVKACNRAGCGPINIITGRTNYSTKSDNVNDLMACKMSH
NNEYRVHFSQPQNSNGHIISYALHFRYLDVSTAGPFLSHMHCLTRLEHARNNFLYVGYLN
STYNQVKVRVESFGHRNYTAWVNITTCSHSPPLTKLAGRGSSGGWNIFFIFFTLGAGGTA
LWVCYKRRYWRKLPKFCNCLPLYTSWRALRPDADNEEDRQILVDGFETVRFHNSPEDDKK
YLVH
Download sequence
Identical sequences A0A1I8PDB1
XP_013109366.1.53170 XP_013109367.1.53170 XP_013109368.1.53170 XP_013109369.1.53170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]