SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013110962.1.53170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013110962.1.53170
Domain Number 1 Region: 398-618
Classification Level Classification E-value
Superfamily Bet v1-like 3.96e-30
Family STAR domain 0.011
Further Details:      
 
Domain Number 2 Region: 60-168
Classification Level Classification E-value
Superfamily PH domain-like 1.9e-24
Family Pleckstrin-homology domain (PH domain) 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_013110962.1.53170
Sequence length 629
Comment PREDICTED: collagen type IV alpha-3-binding protein isoform X1 [Stomoxys calcitrans]; AA=GCF_001015335.1; RF=representative genome; TAX=35570; STAX=35570; NAME=Stomoxys calcitrans; breed=8C7A2A5H3J4; AL=Scaffold; RT=Major
Sequence
MNYVKQLNGGAMNSVVAVAGDSTPLTATAAQFIPKSSANTTMVLNDLVSGSLSDSEPEFI
DNNSVELRGYLSKWTNYIYGWQPRYIVLKDGTLSYYKSESESDFGCRGAISLSRATIKPH
ESDELRFDVVVNNYNNWCLRADTPEDRMHWVEVLRMYKEDSTSTDTNSLRRHGSTMSLQS
NTVSVASGSSLKKTQRNLKEKVGEIETFKDILFGQIETLQRYFDACADINKDMEKPLDLG
DGLKPIDFKGESITFRATTSGVLTTLQHCLDIIAENDETWKHKLEREIEKRKKFEEQNRK
FKEEMEKIKRISYPGPDLEEGPHSTLPEDEFFDAVETGLDKIEEDMQLRVKLKLQSQQSQ
ISTNSIIPAQSENGEDGGDDEKFGTGALAKSHGLWSEIDRVCLEQLHHARQGVGQDGNGW
QIFADEGEIKMYKREEEVNGMVVDPLKAYHSVKGVTAREMCHYFFMPEFRNEWETTLEDC
TILEKISPDTFLFLQTHKRVWPASQRDALFWSHMRKITDGLDEGAADTWIVCNNSTDYSK
QESKNGKCVRIFLTVIMACQTHLPPGKTKTDALSRDDLTCKVTYCSVVNPGGWAPASALR
AIYKREYPKFLKRFTSYVIDQRKDKPIMF
Download sequence
Identical sequences A0A1I8PME0
XP_013110962.1.53170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]