SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013156826.1.75256 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013156826.1.75256
Domain Number 1 Region: 21-433
Classification Level Classification E-value
Superfamily Sema domain 3.79e-78
Family Sema domain 0.002
Further Details:      
 
Domain Number 2 Region: 1304-1429,1595-1752
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-36
Family p120GAP domain-like 0.021
Further Details:      
 
Domain Number 3 Region: 867-957
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000112
Family Other IPT/TIG domains 0.061
Further Details:      
 
Domain Number 4 Region: 777-856
Classification Level Classification E-value
Superfamily E set domains 0.000000000000306
Family Other IPT/TIG domains 0.016
Further Details:      
 
Domain Number 5 Region: 436-488
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000288
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 6 Region: 956-1039
Classification Level Classification E-value
Superfamily E set domains 0.00000000255
Family E-set domains of sugar-utilizing enzymes 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_013156826.1.75256
Sequence length 1819
Comment PREDICTED: plexin-D1 [Falco peregrinus]; AA=GCF_000337955.1; RF=representative genome; TAX=8954; STAX=8954; NAME=Falco peregrinus; AL=Scaffold; RT=Major
Sequence
MAVPSVTTVQQEVACSHAEVQRKFLSPTPTNNFALDGPGSRVYLAAVNRLFQLSGGELAL
EAEAAVGPVLDSPLCHAPQLPQASCEHPKVLTNNYNKILQPDPEQGVLVVCGSIYQGLCQ
LRSMANISAVAVRFPPGGSDPVTVFPSMLNVAANHPNASTVGLVLRRGGGGARLLVAATY
TGFGSPFFPRNRSLEDHRFENTPEIAIRALNARGDLAKLFTFDINPSDDNIFKIKQGAKA
RHKLNFVRAFLQRGAAPPARRPYAYLALNSEANAGDKESPSHSLLARICLGEAAEATLNG
SGENKKLDQLSSIKDRKNICVISKLQPEQLDCGAAHLQHPLAIVNPVTATPVFTYSGLTA
VAVASVNNYTVVFLGTASGGLLKINLDSTMKVISRRSISVAYGEPVHPIMQFDPSDSTYL
YLMTSYQMMRVKVAACNQYLTCMECLAAADAYCGWCTMETRCSLQHECTNFTGANFWASA
SEGVQQCPSMTILEPEINIDKENPALIIQINGTIPNLNGTNISCDYGNDIHTVARVAGDY
VNQFIYCGLLPREKYPAFPDDQDHVVVETALRVNSKNIIRANFTIYDCKRTGNIYPKRAC
TSCLSTRWKCHWCPSTYTCVSNHSQCDDALQMKRKIDCPRIVPASLDPMPTGVSRDITIS
VANATFSKETALECHFGTDRTFEARWVNSSAVECVHVLLHTSEKSHLFPVNLQLKDRPDR
FIDSPEMMTVEVYNCATGSADCSQCLGREDLGHRCIWSESSSSCRLHSEPPQVSDVCPAP
EIKKIEPLRGPLEGGTLLTIRGRNLGRRFSDVLDAVRIGSVQCAPLPNRYVVSEAIVCQT
GEAQEAFSDVVTVNVSREGKSRERYAYVLPVVQSIAPVNGPKAGGTRVTIRGSRLDVGSE
LRVLVNTSKQCTDLSRNDSTITCTMPSAELTMAVRICVQFENKSCASYNITFKYEKNPII
SDINPKKSQISGGRTITLEGRGFELVQNVSMVVRGIGREQTRCKVHTDTTITCPSPAASN
ITVGSKPAPVDFYLNGRLYADDHLALDEEMYPEEALHVSKFSLEYYTDPQFFTAKKEKWI
KHHPGEPLTLVIHKEPDSLGLESNEYQVKIGLISCEIQIVSDKVIHCSVNESLSTSERQL
PVTIQVGKFNYTIAMLHLGGGETAIIVSIVICSILLVLSVVALFVFCTKSRRAERYWQKT
LLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLY
EECYILPSQQLSSQVGSQVQETHPLLVGEWKIPENCRPNMEEGISLFSTLLNNKHFLIVF
VHALEQQKDFAVRDRCNLASLLTIALHGKLEYYTSIMKDLLVDLIDASASKNPKLMLRRT
ESVVEKMLTNWMSICMYSYLRETVGEPFFLLICAIKQQINKGSIDAITGKARYTLNEEWL
LRENIEAKPRNLNVSFQGCGMDSLSVRAMDTDTLSQVKEKILEAFCKNVPYSQWPRVEDV
DLEWFATSTDSYILRDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLSDKKDTTLSRVK
DLDTEKYFHLVLPTDESVEHKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAIL
SIRDDKPPVAVKYFFDFLEEQAEKRGITDPDTMHIWKTNSLPLRFWVNILKNPQFVFDID
KTDHIDACLSVIAQAFIDACSLSDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIHDMP
PLSEQEMNAHLAEESRKYRNEFNTNVAMAEIYKYAKRYRSQIVAALDANPTTKRTQLQHK
FEQVIALMEDNIYECCSEA
Download sequence
Identical sequences XP_013156826.1.75256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]