SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013196521.1.6669 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013196521.1.6669
Domain Number 1 Region: 211-349
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 7.72e-49
Family A middle domain of Talin 1 0.0000305
Further Details:      
 
Domain Number 2 Region: 3-81
Classification Level Classification E-value
Superfamily PH domain-like 2.15e-21
Family Third domain of FERM 0.000074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013196521.1.6669
Sequence length 349
Comment PREDICTED: talin-1-like, partial [Amyelois transitella]; AA=GCF_001186105.1; RF=representative genome; TAX=680683; STAX=680683; NAME=Amyelois transitella; strain=UIUC subculture of SPIRL-1966; AL=Scaffold; RT=Major
Sequence
MKGKNKLVPRLLGVTKDSVLRLDEKTKEILQTWPLTTVRRWCASPNTFTLDFGDYSDQYY
SVQTTEAEQILQVIAGYIDIIVRKQRAKDHLGIDGDEGSAMLEDSVCPSRANIIQHDTFK
SGKVSTESVAKPAVHRPGAEGAKPFAMSHVTGAQQTTVSGQIITGHTPPAASQVQQTKVT
SVLSEPQRALLTTITSGREVIKRSEEGLARLQRALLTTITSGREVIKRSEEGLARATLPD
LGHDATSLKWKQVTLDTNKQVVTSHIAAMNAATAQVVTLTSGPTEEVDHTAVGAAITTIT
SNLPEMTKGVQMLAALLEDDNGDRLLDATRKLCSAFSDLLRAAEPEAKE
Download sequence
Identical sequences XP_013196521.1.6669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]