SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013209504.1.66349 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013209504.1.66349
Domain Number 1 Region: 1017-1082
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.27e-20
Family TB module/8-cys domain 0.00000973
Further Details:      
 
Domain Number 2 Region: 346-413
Classification Level Classification E-value
Superfamily TB module/8-cys domain 6.67e-20
Family TB module/8-cys domain 0.00043
Further Details:      
 
Domain Number 3 Region: 1191-1252
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.97e-17
Family TB module/8-cys domain 0.0015
Further Details:      
 
Domain Number 4 Region: 797-925
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.63e-16
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 5 Region: 679-798
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000173
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 6 Region: 227-296
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000392
Family TB module/8-cys domain 0.0037
Further Details:      
 
Domain Number 7 Region: 587-637
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000728
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 915-971
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000243
Family EGF-type module 0.018
Further Details:      
 
Domain Number 9 Region: 546-601
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000082
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 10 Region: 292-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000089
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 11 Region: 1298-1344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000014
Family EGF-type module 0.013
Further Details:      
 
Domain Number 12 Region: 1333-1378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000309
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 13 Region: 625-667
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000947
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 14 Region: 1135-1180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000142
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 15 Region: 1097-1143
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000635
Family EGF-type module 0.01
Further Details:      
 
Domain Number 16 Region: 77-108
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000112
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_013209504.1.66349
Sequence length 1394
Comment PREDICTED: latent-transforming growth factor beta-binding protein 1 isoform X1 [Microtus ochrogaster]; AA=GCF_000317375.1; RF=representative genome; TAX=79684; STAX=79684; NAME=Microtus ochrogaster; AL=Chromosome; RT=Major
Sequence
MATKLTCLLFFFCLPLLLVSNHTGRIKVVFTPSICKVTCTKGNCQNSCQKGNTTTLISEN
GHAADTLTATNFRVVICHLPCMNGGQCSSRDKCQCPPNFTGKLCQIPVLGASGPKHYQHS
QQPGKALGSHVIHSTHTLPLTMTSQQGVKVKFPPNIVNIHVKHPPEASVQIHQVSRIDSP
MGQKAKEAHPGQSQVSYQGLPVQKTQTVHSTYSHQQVLPHVYPVAAKAQLGRCFQETIGS
QCGKALPGLSKQEDCCGTVGTSWGFNKCQKCPKKPAYHGYTQMMECLQGYKRVNNTFCQD
INECQLQGVCPNGECLNTMGSYRCSCKMGFGPDPTFSSCVPDPPMISEEKGPCYRLVSPG
RQCLHPLSVHLTKQICCCSVGKAWGPHCEKCPLPGTAAFKEICPGGMGYTVSGVHRRRPV
HQHIGKEAVFVKPKNTQPVAKSTHPPPLPAKEEPVEALSSSRELGPGGAEPEVVTAPPEK
EIPSLDQEKTRLEPGQPQLSPGISTIHLHPQFPVVIEKTSPPVPVEVAPEASTSSASQVI
APTQVTEINECTVNPDICGAGHCINLPVRYTCICYDGYRFSEQQRKCVDIDECAQVQHLC
SQGRCENTEGSFLCICPAGFMASEEGTSCVDVDECLRLDVCREGRCINTVGAFRCEYCDS
GYRMTRRGHCEDIDECLTPSTCPDEQCVNSPGSYQCIPCTEGFRGWNGQCLDVDECLQPK
VCTNGSCTNLEGSYMCSCHKGYSPTPDHRHCQDVDECQQGNLCMNGQCKNTDGSFRCTCG
QGYQLSAAKDQCEDIDECQHHHLCSHGQCRNTEGSFQCVCNQGYRASALGDHCEDINECL
EDSSVCQGGDCINTAGSYDCTCPDGFQLNDNKGCQDINECAQPGLCGPHGECLNTQGSFH
CACEQGFSISADGRTCQDIDECVNNTVCDSHGFCDNTAGSFRCLCYQGFQAPQDGQGCVD
VNECELLSGVCGEAFCENVEGSFLCVCADESQEYSPMTGQCRSRVTEDSGVDHQPKEEKK
ECYYNLNDASLCDNVLAPNVTKQECCCTSGAGWGDNCEIFPCPVQGTAEFTEMCPRGKGF
VPVGESSYDAGGENYKDADECLLFGEEICKNGYCLNTQPGYECYCKQGTYYDSVKLQCFD
MDECQDPNSCIDGQCVNTEGSYNCFCTHPMVLDASERRCVQPTESNEQIEETDVYQDLCW
EHLSEEYVCSRPLVGKQTTYTECCCLYGEAWGMQCALCPMKDSDDYAQLCNIPVTGRRRP
YGRDALVDFSEQYGPETDPYFIQDRILNSFEELQAEECGILNGCENGRCVRVQEGYTCDC
FDGYHLDMAKMTCVDVNECSELNNRMSLCKNAKCINTEGSYKCLCLPGYVPSDKPNYCTL
SNTALNFDKEGDLE
Download sequence
Identical sequences XP_013209504.1.66349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]