SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013217053.1.77405 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013217053.1.77405
Domain Number 1 Region: 2221-2314
Classification Level Classification E-value
Superfamily C-type lectin-like 7.22e-33
Family Link domain 0.00014
Further Details:      
 
Domain Number 2 Region: 518-657
Classification Level Classification E-value
Superfamily FAS1 domain 1.57e-28
Family FAS1 domain 0.0018
Further Details:      
 
Domain Number 3 Region: 1483-1531,1612-1723
Classification Level Classification E-value
Superfamily FAS1 domain 2.35e-27
Family FAS1 domain 0.0021
Further Details:      
 
Domain Number 4 Region: 1733-1880
Classification Level Classification E-value
Superfamily FAS1 domain 1.57e-25
Family FAS1 domain 0.0054
Further Details:      
 
Domain Number 5 Region: 975-1131
Classification Level Classification E-value
Superfamily FAS1 domain 8.89e-22
Family FAS1 domain 0.0056
Further Details:      
 
Domain Number 6 Region: 2312-2475
Classification Level Classification E-value
Superfamily FAS1 domain 1.07e-16
Family FAS1 domain 0.0095
Further Details:      
 
Domain Number 7 Region: 386-498
Classification Level Classification E-value
Superfamily FAS1 domain 0.0000000000000222
Family FAS1 domain 0.0081
Further Details:      
 
Domain Number 8 Region: 1142-1263
Classification Level Classification E-value
Superfamily FAS1 domain 0.000000000353
Family FAS1 domain 0.0067
Further Details:      
 
Domain Number 9 Region: 1555-1592
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000304
Family Merozoite surface protein 1 (MSP-1) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_013217053.1.77405
Sequence length 2584
Comment stabilin-1 [Ictidomys tridecemlineatus]; AA=GCF_000236235.1; RF=representative genome; TAX=43179; STAX=43179; NAME=Ictidomys tridecemlineatus; AL=Scaffold; RT=Major
Sequence
MAEPRGLLLLCVLVSCLANSSFIRGQKVQFKRCDIKTTLVKHTPCTTCAAIKKQVCPSGW
RRFPEKISQDCSYEIKLGDTVMSKSGCNLECWKEVVQKACCPGYWGSQCYECPGGAETPC
NGHGTCLDGMARNGTCACQENFSGSACQECRDPHRFGPDCQSVCSCVHGVCKSGPLGDGS
CLCFAGYTGPRCDQELHVCQALSCPQHTQCSAEDPTCKCLPGYTQQGSVCLAPNPCQPSP
CSPLARCSVSPNGKAQCHCPENYHGDGKVCLPQDPCTIDFGGCPSNSTLCLYQSPGKATC
SCQPGLISINNNASMGCFAVCYSYSCDLSATCQLTPEGKTRCVCKEDEVGDGRACYGHLL
SEVQKARQTGLMVMQLRVAISMFEQGCQEILTSSGPFTVLVPSIIFSRFFTTKTMIPLLA
QKLCRQYIIPGQHMLQDLGLQSTHTWWTLAGKEITVTNNRLRYSYVYKDQPQKTFNIQKA
NYIAANGIFHVVSYLRWELPSETSRDPKNPHEDSSQQKTIGQILASTEAFSRFEIILENC
GLPSILDGPGPFTVFVPSNEAVDSLRDGRLIYLFTAGLSKLQELVKYHIYNHGQLTVEKL
ISKGRVLTMANQVLNVNISEEGRILLGPKGVPLRRVDVLASNGVIHVLEGILLPPTILPI
LPKHCGEDQYNIVAGSCVDCQALNTSTCPPNSVKLDIFPKECIYIHDPMGLNVLKKGCAR
YCNQTVTKLGCCKGFFGPDCTQCPGGFSNPCYGKGNCSDGIQGNGACLCFPDYKGLACHI
CSNPNKHGDQCQEDCGCVHGLCDNRPGSGGVCQHGTCAPGFRGRFCNESVEDCGPTGLAK
HCHLNARCVSQEGVARCVCLDGFEGDGYSCTRSHPCSRPDRGGCSENAECVPGDKGTHHC
TCHRGWSGDGRVCVAIDECGLDTRGGCHADALCSYVGPGQSRCTCKLGFAGDGYECSPID
PCRAGNGGCHGLATCQAVGGGQRICKCPPGFGGDGLSCYGDIIRELQANAHFSAFSQWFQ
NASITLPANGQVTALVPSESAIRRLNPEDRAFWLQPKMLPHLVRAHFLQGALSEEELAQL
DRQNVTTLDPTTRWEIRNISGRVWVQNASVDVADLLATNGVLHILSQVLLPSRADVQGGQ
GLLQQLDLVPAFRLFRELLQRHGLVPQIEAATAYTIFVPTNSSLEAQSNGSSLNADTVRH
HVILGEALSVEALRKGGHRNSLLGSAHWLVFYNHSGQPEVNHVPLEGPLLEAPGSSLFGL
SGILTVGSSRCLHSHAEALREKCINCTGKFRCTRGFQLQDTPRKSCVYRSGFSFSRGCSY
TCVKKIQVPDCCPGFFGILCEPCPGGLGGVCSGHGQCQDRLLGSGECRCHEGFHGTACEM
CELGRYGPSCAGVCDCAHGMCQEGLQGDGSCVCNVGWQGLRCDQKIVDPQCPKKCDPNAN
CIQNSTGPPTCVCAAGYSGNGSYCSEVDPCANGHGGCSPHANCTKVAPGQRTCTCQDGYT
GDGELCQEINSCLIRNGGCHIHAECIPTGPQQVSCSCHEGYSGDGIRTCDLLDPCSQNNG
GCSPYATCKSTGDGQRTCTCNRIQTVGDGFTCRARLSLELFRDKHASFFSRHLLEYTELK
GNGPFTVFVPQADLMTNLSQNELARIRANRQLVFRYHVVGCQQLHTQELLDQGYATALSG
HTLRFSEREGSIYLNDFARVVSSDHEAVNGILHFIDRVLLPPEVLHWEPDATPIPSPPRN
VTDAAESFGYKIFSHLVTVAGLLPMLRDVSHRPLTMLWPTDSALQALPPDRQAWLYHEDH
RDKLAAILRGHVIRNVEALASDMPNLGSLRTMHGTPISFSCSRARPGELMVGEDDARIVQ
RYMPFEGGLAYGIDQLLEPPGLGARCDRFETRPLRLKTCSICGLEPPCPEGSWEQGSPET
CWRYYAKLWSSPSLHSLALGNIWVRPSFWSHPQGKSRGCHRNCVTTTWVPSCCPGHYGSE
CQACPGSPRSPCNGHGVCLDGMSGSGRCRCHSGFTGTACELCTSGFFGPQCQACSCTSHG
RCDEGLGGSGSCFCDEGWTGPRCEVQLELQPVCTPPCAPQAMCRAGNSCECSLGYEGDGR
VCTVADLCQDGRGGCSEHANCSQVGTVVTCVCLPDYEGDGWSCRARNPCADGHHGGCSEH
ADCLNTGPNTRRCECHAGYVGDGLQCLEEAAPPVDRCLGHPSPCHTDAVCTDLHFQEKRA
GVFHLQATSGPYGLNFSEAEAACADQGAVLASVSQLSAAQQLGFHLCLMGWLANGSAAHP
VVFPAADCGDGRVGVVSLGVRKNLSEPWDAYCYREQDVACQCKAGFVGDGISICNGKLLD
VLAATANFSTFYGMLLGYANATQKGFDFLRFLDDELTYKTLFVPVNEGFVDNMTLSGPDL
ELHASNATFLSTNASQGTLLPAHSGVSLVISDTGPGNNSWAPVAPGAVLVGRVIIWDIMA
FNGIIHALASPLLAPPQPGAVLAPEAPQVAAGVGAVVAAGTLISLVAGVLYLRARGKPTG
FGFSAFQAEDDAGDDFSPWQEVNSPTLVSVPNPVFGNHDAFCEPFDDSLLEDDFPDTQRI
LAVK
Download sequence
Identical sequences XP_013217053.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]