SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013221390.1.77405 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013221390.1.77405
Domain Number 1 Region: 231-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.88e-25
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 2 Region: 92-148
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.82e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 455-512
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-24
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 4 Region: 371-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.92e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 287-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-23
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 6 Region: 175-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.67e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 7 Region: 1-55
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.24e-20
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 8 Region: 501-553
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.07e-18
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 9 Region: 53-105
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-17
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 10 Region: 138-170
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000625
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 11 Region: 334-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000156
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 12 Region: 419-450
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000361
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013221390.1.77405
Sequence length 558
Comment zinc finger protein 91-like [Ictidomys tridecemlineatus]; AA=GCF_000236235.1; RF=representative genome; TAX=43179; STAX=43179; NAME=Ictidomys tridecemlineatus; AL=Scaffold; RT=Major
Sequence
MISSQGVLTFRDVVIRFSEEEWKCLNPAQRALYKDVMLENFRNLVFVGENTSKQYKCKHC
AKTFKCSSSLVIHQRIHTGEKPYKCKDCGKAYISSSQLNIHKRVHTGEKPYKCESCGKAF
AHSSSLAVHQRIHTGEKPHKCNECGKAFIRSSILNVHKRIHTREKHYKCQVCEKAFIHAS
QFAIHKRTHTGEKPYKCNECGKSFICSSHLSVHKRIHTGEKSYKCESCGKAFARSSYLVV
HQRIHTGEKPHKCSECGKRFIRSSTLNVHQRIHTGDKPHKCNECGKAFICSSILNVHKRI
HTGEKSYKCESCGKAFATSSYLAVHQRIHIGEKPHKCNECGKAFICSSTLNVHKRIHTGV
KSYKCESCGKAFSSSSYLAVHQRIHTGYKPYHCKDCGKTFISSSELQRHQRIHTGEKYYK
CQECGKAFNHSSQFAIHKRIHTGEKPHKCNDCGKAFVSSSTLSVHKRIHTGEKSYKCESC
GKAFAHSSSLAVHQRIHTGEKPHKCNECGKAFICSSTLNMHKRIHTGVKPYKCESCGKAF
SRFLYLDVHQRIHTGEKH
Download sequence
Identical sequences XP_013221390.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]