SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013232776.1.50571 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013232776.1.50571
Domain Number 1 Region: 698-751
Classification Level Classification E-value
Superfamily RING/U-box 6.6e-16
Family RING finger domain, C3HC4 0.0066
Further Details:      
 
Domain Number 2 Region: 482-558
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 0.000000000000131
Family Cdc48 domain 2-like 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_013232776.1.50571
Sequence length 783
Comment hypothetical protein, conserved [Eimeria tenella]; AA=GCF_000499545.2; RF=representative genome; TAX=5802; STAX=5802; NAME=Eimeria tenella; strain=Houghton; AL=Scaffold; RT=Minor
Sequence
MTGAADDSPQSVNTGSKDSRAPSVCNVSTSSSIVCNEAEEGEAAGSGDAEYCAANSQGDS
ICSEGAHNPTMNSTATERTAVEKIHLLPISEEAPKSWVFATLTGLMKECKTVQQYMYIRV
KRPVKENKSPQKARGCDESDKGVSSEATDAEYNYIVVACLPHSGVITPSTVVFTTGAPLK
PLRRIQLLALVHPNSSYARKAGVASYSEALQRGLVGEGSAASQSRRSRRADSTSRSAASP
PQRPENNSNGIENGVTTGEAGYGAADAERHRRQLGSPFDWEDTHAAGHRHRRRPAPVREF
SRAEDVIAAVLEDSDAGSGEENGGDEDSMGGGTPFRLSDATGPEASGTRSDSNEAEPPMQ
HQRTLQLNFNFSSSFSTDFGQSMSGTDGSPGDAPRSLSEKVLFYDFVAPYFRARGAGASL
PSSPANAGTDGTSRDTAIVVFPGKKLVIRDLTFVVWATDPDNGPGFVRKDTAMYISVDPW
GEYRRVHILPFADTLPTTYSFRLFEDYLQPFLKEQPWRLIRKGDIFTFRGVEFKVIATEP
STIPVARVGPETVVHFEGSLNPSLIDILPPDILSRVRRLPARVQPFAIVAAAQSLDPQLL
LRVLPSGNMRGNPRGIDEGLEAAVERQLVGPFCLSAYQRLYAHLCTRKKRHPSREKREEA
EANGEADAPGCSQEIPSSRSSTAEAEAAVAEAAAGGWELEAPCCTVCTLQLQDGAESVTL
TCGHAFHWDCARAWLRCSATCPNCRAEVVLPSEDHGECRGSNTSVGTAALGFVRSAWADF
FNS
Download sequence
Identical sequences U6KVN5
XP_013232776.1.50571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]